SRP54 (NM_003136) Human Recombinant Protein
CAT#: TP301658
Recombinant protein of human signal recognition particle 54kDa (SRP54), 20 µg
View other "SRP54" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201658 representing NM_003136
Red=Cloning site Green=Tags(s) MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLN KRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTF RAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVAN AIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHID DFEPFKTQPFISKLLGMGDIEGLIDKVNELKLDDNEALIEKLKHGQFTLRDMYEQFQNIMKMGPFSQILG MIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQEL LTQYTKFAQMVKKMGGIKGLFKGGDMSKNVSQSQMAKLNQQMAKMMDPRVLHHMGGMAGLQSMMRQFQQG AAGNMKGMMGFNNM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 25524922) |
Reference Data | |
RefSeq | NP_003127 |
Locus ID | 6729 |
UniProt ID | P61011 |
Refseq Size | 2164 |
Cytogenetics | 14q13.2 |
Refseq ORF | 1512 |
Synonyms | SCN8 |
Summary | Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Protein export |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Anti-signal recognition particle autoantibody ELISA validation and clinical associations
,Aggarwal, R;Oddis, CV;Goudeau, D;Fertig, N;Metes, I;Stephens, C;Qi, Z;Koontz, D;Levesque, MC;,
Rheumatology (Oxford)
,PubMed ID 25524922
[SRP54]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418879 | SRP54 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431398 | SRP54 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418879 | Transient overexpression lysate of signal recognition particle 54kDa (SRP54), transcript variant 1 |
CNY 3,080.00 |
|
LY431398 | Transient overexpression lysate of signal recognition particle 54kDa (SRP54), transcript variant 2 |
CNY 3,080.00 |
|
PH301658 | SRP54 MS Standard C13 and N15-labeled recombinant protein (NP_003127) |
CNY 19,520.00 |