Dusp11 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Dusp11 antibody is: synthetic peptide directed towards the middle region of Mouse Dusp11. Synthetic peptide located within the following region: AFKVPLQKKFEAKLMPEECFSPLDLFNKIQEQNEELGLIIDLTYTQRYYK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
Database Link	NP_082375 Entrez Gene 72102 Mouse UniProt ID Q6NXK5
Background	It has both, RNA 5'-diphosphatase and 5'-triphosphatase activities, but displays a poor protein-tyrosine phosphatase activity.Dusp11 binds to RNA. Dusp11 may participate in nuclear mRNA metabolism.
Synonyms	PIR1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Rat: 79%; Horse: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.