HDLBP Rabbit Polyclonal Antibody
CAT#: TA345916
Rabbit Polyclonal Anti-HDLBP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HDLBP antibody: synthetic peptide directed towards the middle region of human HDLBP. Synthetic peptide located within the following region: RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 141 kDa |
Gene Name | high density lipoprotein binding protein |
Database Link | |
Background | HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigi |
Synonyms | HBP; PRO2900; VGL |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |