ALS (IGFALS) Rabbit Polyclonal Antibody
CAT#: TA346388
Rabbit Polyclonal Anti-IGFALS Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | insulin like growth factor binding protein acid labile subunit |
Database Link | |
Background | IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. |
Synonyms | ACLSD; ALS |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |