SLC17A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC17A3 antibody: synthetic peptide directed towards the middle region of human SLC17A3. Synthetic peptide located within the following region: FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	solute carrier family 17 member 3
Database Link	NP_006623 Entrez Gene 10786 Human UniProt ID O00476
Background	SLC17A3 may be involved in actively transporting phosphate into cells via Na(+) cotransport.
Synonyms	NPT4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.