GMP Synthase (GMPS) Rabbit Polyclonal Antibody

CAT#: TA346719

Rabbit Polyclonal Anti-GMPS Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of guanine monphosphate synthetase (GMPS)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human guanine monphosphate synthetase (GMPS), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human guanine monphosphate synthetase (GMPS), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 77 kDa
Gene Name guanine monophosphate synthase
Background In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. [provided by RefSeq, Jul 2008]
Synonyms glutamine amidotransferase; GMPS fusion protein; GMP synthase; GMP synthetase; guanine monophosphate synthetase; guanine monphosphate synthetase; guanosine 5'-monophosphate synthase; MLL
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families Stem cell - Pluripotency
Protein Pathways Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...