Polr2e (BC026842) Mouse Tagged ORF Clone

CAT#: MG201273

  • TrueORF®

Polr2e (tGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide E (cDNA clone MGC:28579 IMAGE:4210827)

ORF Plasmid: DDK tGFP



  "BC026842" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,090.00


货期*
4周

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms RPB5, XAP4, 25kDa
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201273 representing BC026842
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGACGAGGAGGAGACCTACCGGCTGTGGAAGATCCGCAAGACGATCATGCAGCTGTGTCATGACC
GTGGCTACCTGGTGACCCAGGATGAACTGGACCAGACACTTGAGGAATTCAAGGCGCAGTTTGGGGACAA
GCCCAGCGAAGGACGGCCAAGGCGCACAGACCTCACGGTGCTGGTGGCCCACAACGATGACCCCACAGAC
CAGATGTTTGTGTTCTTCCCAGAGGAGCCCAAGGTGGGCATCAAGACCATCAAGGTATACTGCCAGCGCA
TGCAGGAGGAAAACATCACACGGGCGCTGATTGTGGTGCAGCAGGGCATGACGCCCTCCGCCAAGCAGTC
CCTGGTGGACATGGCCCCGAAGTATGTGCTGGAACAGTTTCTACAGCAGGAGCTGCTCATCAATATCACA
GAGCACGAGCTAGTCCCTGAGCACGTGGTCATGACAAAGGAGGAGGTGACTGAACTGCTGGCTCGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201273 representing BC026842
Red=Cloning site Green=Tags(s)

MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTD
QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQFLQQELLINIT
EHELVPEHVVMTKEEVTELLAR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC026842
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC026842.1
RefSeq Size 1289 bp
RefSeq ORF 488 bp
Locus ID 66420
Gene Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2E/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...