Kcnmb1 (NM_031169) Mouse Tagged ORF Clone

CAT#: MG201831

  • TrueORF®

Kcnmb1 (tGFP-tagged) - Mouse potassium large conductance calcium-activated channel, subfamily M, beta member 1 (Kcnmb1)

ORF Plasmid: DDK tGFP



  "NM_031169" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms BKbeta1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201831 representing NM_031169
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAGAAGCTGGTGATGGCCCAGAAGCGCGGAGAGACACGAGCCCTCTGCCTGGGAGTGGCAATGG
TAGTGTGTGCTGCCATCACCTACTACGTCCTGGGTACAACTGTGCTGCCCCTCTACCAGAAAAGTGTGTG
GACCCAGGAATCCATATGTCACTTGATTGAAACTAATATCAAGGACCAGGAAGAGCTGGAGGGCAAGAAG
GTGCCCCAGTACCCATGCCTTTGGGTCAATGTATCAGCTGTGGGCAGATGGGCCATGCTGTATCACACGG
AAGACACTCGGGATCAAAACCAACAGTGCTCCTATATCCCCAGGAACCTGGACAACTACCAGACAGCCTT
GGCAGATGTGAAGAAGGTCAGAGCCAATTTCTATAAGCACCATGAATTCTATTGCCTTTCTGCACCTCAA
GTCAACGAGACCAGCGTCGTGTACCAGCGCCTCTACGGGCCCCAAGTCCTCCTCTTCTCCTTCTTCTGGC
CCACCTTCCTGCTGACTGGGGGTCTTCTTCTTATTGCCATGGTGAAGCTCAACAGGTCCCTATCCATCTT
GGCAGCTCAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201831 representing NM_031169
Red=Cloning site Green=Tags(s)

MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNIKDQEELEGKK
VPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADVKKVRANFYKHHEFYCLSAPQ
VNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLLLIAMVKLNRSLSILAAQK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031169
ORF Size 573 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_031169.2, NP_112446.2
RefSeq Size 1552 bp
RefSeq ORF 576 bp
Locus ID 16533
UniProt ID Q8CAE3
Gene Summary Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...