Tff3 (NM_011575) Mouse Tagged ORF Clone
CAT#: MR200151
- TrueORF®
Tff3 (Myc-DDK-tagged) - Mouse trefoil factor 3, intestinal (Tff3)
ORF Plasmid: tGFP
"NM_011575" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ITF; mITF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200151 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGACCAGAGCCCTCTGGCTAATGCTGTTGGTGGTCCTGGTTGCTGGGTCCTCTGGGATAGCTGCAG ATTACGTTGGCCTGTCTCCAAGCCAATGTATGGTGCCGGCAAATGTCAGAGTGGACTGTGGCTACCCCTC TGTCACATCGGAGCAGTGTAACAACCGTGGCTGCTGCTTTGACTCCAGTATCCCAAATGTGCCCTGGTGC TTCAAACCTCTGCAGGAGACAGAATGCACATTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200151 protein sequence
Red=Cloning site Green=Tags(s) METRALWLMLLVVLVAGSSGIAADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWC FKPLQETECTF myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_011575 |
ORF Size | 246 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011575.2 |
RefSeq Size | 458 bp |
RefSeq ORF | 246 bp |
Locus ID | 21786 |
UniProt ID | Q62395 |
MW | 8.8 kDa |
Gene Summary | Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
TFF3 interacts with LINGO2 to regulate EGFR activation for protection against colitis and gastrointestinal helminths
,null,
Nature Communications
,PubMed ID 31562318
[Tff3]
|
TFF3 is a ligand for LINGO2 that de-represses EGFR to control disease outcome during colitis and gastrointestinal nematode infection
,Ji, Y;Wei, Y;Park, J;Hung, L;Young, T;Herbine, K;Oniskey, T;Pastore, C;Nieves, W;Somsouk, M;Herbert, D;,
bioRxiv
[TFF3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204273 | Tff3 (untagged) - Mouse trefoil factor 3, intestinal (Tff3), (10ug) |
CNY 1,800.00 |
|
MG200151 | Tff3 (tGFP-tagged) - Mouse trefoil factor 3, intestinal (Tff3) |
CNY 3,400.00 |
|
MR200151L1 | Lenti ORF clone of Tff3 (Myc-DDK-tagged) - Mouse trefoil factor 3, intestinal (Tff3) |
CNY 4,200.00 |
|
MR200151L2 | Lenti ORF clone of Tff3 (mGFP-tagged) - Mouse trefoil factor 3, intestinal (Tff3) |
CNY 5,890.00 |
|
MR200151L3 | Lenti ORF clone of Tff3 (Myc-DDK-tagged) - Mouse trefoil factor 3, intestinal (Tff3) |
CNY 5,890.00 |
|
MR200151L4 | Lenti ORF clone of Tff3 (mGFP-tagged) - Mouse trefoil factor 3, intestinal (Tff3) |
CNY 5,890.00 |