Sfswap (BC013466) Mouse Tagged ORF Clone
CAT#: MR200211
- TrueORF®
(Myc-DDK-tagged) - Mouse cDNA clone MGC:18835 IMAGE:4211168
ORF Plasmid: tGFP
"BC013466" in other vectors (3)
Need custom modification / cloning service?
Get a free quote
CNY 1,900.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 1190005N23Rik; 6330437E22Rik; AI197402; AW212079; Sfrs8; Srsf8; SWAP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200211 representing BC013466
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200211 representing BC013466
Red=Cloning site Green=Tags(s) MAGTEKGGFAEPGDSGGLPAPHVPRRPGGGDGETGPKAPARAGASPSPEGSTLLPQPLEPGLPLATQRGW KLSGARPPAPWGGCRCPSAGCAGRESGSALLFLRSAARRGPWVEASFGPPNPVR myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC013466 |
ORF Size | 266 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC013466 |
RefSeq Size | 1814 bp |
RefSeq ORF | 266 bp |
Locus ID | 231769 |
MW | 66.4 kDa |
Gene Summary | Plays a role as an alternative splicing regulator. Regulates its own expression at the level of RNA processing. Also regulates the splicing of fibronectin and CD45 genes. May act, at least in part, by interaction with other R/S-containing splicing factors. Represses the splicing of MAPT/Tau exon 10 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG200211 | (tGFP-tagged) - Mouse cDNA clone MGC:18835 IMAGE:4211168 |
CNY 2,090.00 |
|
MR200211L3 | Lenti ORF clone of MGC:18835 (Myc-DDK-tagged) - Mouse cDNA clone MGC:18835 IMAGE:4211168 |
CNY 3,800.00 |
|
MR200211L4 | Lenti ORF clone of MGC:18835 (mGFP-tagged) - Mouse cDNA clone MGC:18835 IMAGE:4211168 |
CNY 3,800.00 |