Cxcl5 (NM_009141) Mouse Tagged ORF Clone
CAT#: MR200761
- TrueORF®
Cxcl5 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 5 (Cxcl5)
ORF Plasmid: tGFP
"NM_009141" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AMCF; AMCF-II; Cxcl; Cxcl6; ENA-; ENA-78; GCP-; GCP-2; L; LIX; Scyb; Scyb5; Scyb6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200761 representing NM_009141
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGCCTCCAGCTCCGCAGCTCCGCCCACATCCCCAGCGGTTCCAGCTCGCCATTCATGCGGATGGCGC CGCTGGCATTTCTGTTGCTGTTCACGCTGCCGCAGCATCTAGCTGAAGCTGCCCCTTCCTCAGTCATAGC CGCAACGGAGCTGCGTTGTGTTTGCTTAACCGTAACTCCAAAAATTAATCCCAAATTGATCGCTAATTTG GAGGTGATCCCTGCAGGTCCACAGTGCCCTACGGTGGAAGTCATAGCTAAACTGAAAAACCAGAAGGAGG TCTGTCTGGATCCAGAAGCTCCTGTGATAAAGAAAATCATTCAGAAAATATTGGGCAGTGACAAAAAGAA AGCTAAGCGGAATGCACTCGCAGTGGAAAGAACGGCCAGTGTTCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200761 representing NM_009141
Red=Cloning site Green=Tags(s) MSLQLRSSAHIPSGSSSPFMRMAPLAFLLLFTLPQHLAEAAPSSVIAATELRCVCLTVTPKINPKLIANL EVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIKKIIQKILGSDKKKAKRNALAVERTASVQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_009141 |
ORF Size | 396 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_009141.1 |
RefSeq Size | 1655 bp |
RefSeq ORF | 399 bp |
Locus ID | 20311 |
UniProt ID | P50228 |
MW | 14.7 kDa |
Gene Summary | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils and to have homeostatic and inflammatory functions. In mouse, deficiency of this gene is associated with increased lung inflammation that is neutrophil-dependent. [provided by RefSeq, May 2013] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
IL-17/CXCL5 signaling within the oligovascular niche mediates human and mouse white matter injury
,null,
Cell reports
,PubMed ID 36543124
[Cxcl5]
|
Endothelial CXCL5 negatively regulates myelination and repair after white matter stroke
,Xiao, G;Kumar, R;Burguet, J;Komuro, Y;Kakarla, V;,
bioRxiv
[CXCL5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC202149 | Cxcl5 (untagged) - Mouse chemokine (C-X-C motif) ligand 5 (Cxcl5), (10ug) |
CNY 1,800.00 |
|
MG200761 | Cxcl5 (tGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 5 (Cxcl5) |
CNY 4,370.00 |
|
MR200761L3 | Lenti ORF clone of Cxcl5 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 5 (Cxcl5) |
CNY 4,200.00 |
|
MR200761L4 | Lenti ORF clone of Cxcl5 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 5 (Cxcl5) |
CNY 4,200.00 |