Ifitm3 (NM_025378) Mouse Tagged ORF Clone
CAT#: MR200854
- TrueORF®
Ifitm3 (Myc-DDK-tagged) - Mouse interferon induced transmembrane protein 3 (Ifitm3)
ORF Plasmid: tGFP
"NM_025378" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 1110004C05Rik; Cd225; Cdw217; DSPA2b; Fgls; IP15; mil-1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200854 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACCACACTTCTCAAGCCTTCATCACCGCTGCCAGTGGAGGACAGCCCCCAAACTACGAAAGAATCA AGGAAGAATATGAGGTGGCTGAGATGGGGGCACCGCACGGATCGGCTTCTGTCAGAACTACTGTGATCAA CATGCCCAGAGAGGTGTCGGTGCCTGACCATGTGGTCTGGTCCCTGTTCAATACACTCTTCATGAACTTC TGCTGCCTGGGCTTCATAGCCTATGCCTACTCCGTGAAGTCTAGGGATCGGAAGATGGTGGGTGATGTGA CTGGAGCCCAGGCCTACGCCTCCACTGCTAAGTGCCTGAACATCAGCACCTTGGTCCTCAGCATCCTGAT GGTTGTTATCACCATTGTTAGTGTCATCATCATTGTTCTTAACGCTCAAAACCTTCACACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200854 protein sequence
Red=Cloning site Green=Tags(s) MNHTSQAFITAASGGQPPNYERIKEEYEVAEMGAPHGSASVRTTVINMPREVSVPDHVVWSLFNTLFMNF CCLGFIAYAYSVKSRDRKMVGDVTGAQAYASTAKCLNISTLVLSILMVVITIVSVIIIVLNAQNLHT myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_025378 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_025378.2 |
RefSeq Size | 648 bp |
RefSeq ORF | 414 bp |
Locus ID | 66141 |
UniProt ID | Q9CQW9 |
MW | 15 kDa |
Gene Summary | IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV) and Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV) and human immunodeficiency virus type 1 (HIV-1). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Plays a critical role in the structural stability and function of vacuolar ATPase (v-ATPase). Establishes physical contact with the v-ATPase of endosomes which is critical for proper clathrin localization and is also required for the function of the v-ATPase to lower the pH in phagocytic endosomes thus establishing an antiviral state. Involved in initiating germ cell competence and specification, and in the demarcation of PGCs from their somatic neighbors.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC200663 | Ifitm3 (untagged) - Mouse interferon induced transmembrane protein 3 (Ifitm3), (10ug) |
CNY 1,200.00 |
|
MG200854 | Ifitm3 (tGFP-tagged) - Mouse interferon induced transmembrane protein 3 (Ifitm3) |
CNY 2,850.00 |
|
MR200854L3 | Lenti ORF clone of Ifitm3 (Myc-DDK-tagged) - Mouse interferon induced transmembrane protein 3 (Ifitm3) |
CNY 3,600.00 |
|
MR200854L4 | Lenti ORF clone of Ifitm3 (mGFP-tagged) - Mouse interferon induced transmembrane protein 3 (Ifitm3) |
CNY 3,600.00 |