Il15 (NM_008357) Mouse Tagged ORF Clone
CAT#: MR201274
- TrueORF®
Il15 (Myc-DDK-tagged) - Mouse interleukin 15 (Il15)
ORF Plasmid: tGFP
"NM_008357" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 1,995.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AI503618; IL-15 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR201274 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAAATTTTGAAACCATATATGAGGAATACATCCATCTCGTGCTACTTGTGTTTCCTTCTAAACAGTC ACTTTTTAACTGAGGCTGGCATTCATGTCTTCATTTTGGGCTGTGTCAGTGTAGGTCTCCCTAAAACAGA GGCCAACTGGATAGATGTAAGATATGACCTGGAGAAAATTGAAAGCCTTATTCAATCTATTCATATTGAC ACCACTTTATACACTGACAGTGACTTTCATCCCAGTTGCAAAGTTACTGCAATGAACTGCTTTCTCCTGG AATTGCAGGTTATTTTACATGAGTACAGTAACATGACTCTTAATGAAACAGTAAGAAACGTGCTCTACCT TGCAAACAGCACTCTGTCTTCTAACAAGAATGTAGCAGAATCTGGCTGCAAGGAATGTGAGGAGCTGGAG GAGAAAACCTTCACAGAGTTTTTGCAAAGCTTTATACGCATTGTCCAAATGTTCATCAACACGTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR201274 protein sequence
Red=Cloning site Green=Tags(s) MKILKPYMRNTSISCYLCFLLNSHFLTEAGIHVFILGCVSVGLPKTEANWIDVRYDLEKIESLIQSIHID TTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELE EKTFTEFLQSFIRIVQMFINTS myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_008357 |
ORF Size | 489 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_008357.2 |
RefSeq Size | 1297 bp |
RefSeq ORF | 489 bp |
Locus ID | 16168 |
UniProt ID | P48346 |
MW | 18.6 kDa |
Gene Summary | This gene encodes a a pleiotropic cytokine of the interleukin family of proteins that plays important roles in the innate and adaptive cell homeostasis, as well as peripheral immune function. The encoded protein undergoes proteolytic processing to generate a mature cytokine that stimulates the proliferation of natural killer cells. The transgenic mice overexpressing the encoded protein exhibit an increase in the number of memory CD8+ T cells in a naive state and enhanced protection against bacterial infections. Mice lacking the encoded protein exhibit impaired protection against a strain of attenuated Mycobacterium. [provided by RefSeq, Aug 2016] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Interleukin-23 engineering improves CAR T cell function in solid tumors
,Ma, X;Shou, P;Smith, C;Chen, Y;Du, H;Sun, C;Porterfield Kren, N;Michaud, D;Ahn, S;Vincent, B;Savoldo, B;Pylayeva-Gupta, Y;Zhang, S;Dotti, G;Xu, Y;,
Nat. Biotechnol.
,PubMed ID 32015548
[IL15]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204242 | Il15 (untagged) - Mouse interleukin 15 (Il15), (10ug) |
CNY 1,800.00 |
|
MG201274 | Il15 (tGFP-tagged) - Mouse interleukin 15 (Il15) |
CNY 2,090.00 |
|
MR201274L1 | Lenti ORF clone of Il15 (Myc-DDK-tagged) - Mouse interleukin 15 (Il15) |
CNY 3,800.00 |
|
MR201274L2 | Lenti ORF clone of Il15 (mGFP-tagged) - Mouse interleukin 15 (Il15) |
CNY 4,200.00 |
|
MR201274L3 | Lenti ORF clone of Il15 (Myc-DDK-tagged) - Mouse interleukin 15 (Il15) |
CNY 4,200.00 |
|
MR201274L4 | Lenti ORF clone of Il15 (mGFP-tagged) - Mouse interleukin 15 (Il15) |
CNY 4,200.00 |