Lin28a (NM_145833) Mouse Tagged ORF Clone
CAT#: MR202250
- TrueORF®
Lin28a (Myc-DDK-tagged) - Mouse lin-28 homolog A (Lin28a)
ORF Plasmid: tGFP
"NM_145833" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AL024421; ENSMUSG00000070700; Gm10299; Lin-28; lin-28A; Lin28; Tex17 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR202250 representing NM_145833
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCTCGGTGTCCAACCAGCAGTTTGCAGGTGGCTGCGCCAAGGCAGCGGAGAAGGCGCCAGAGGAGG CGCCGCCTGACGCGGCCCGAGCGGCAGACGAGCCGCAGCTGCTGCACGGGGCCGGCATCTGTAAGTGGTT CAACGTGCGCATGGGGTTCGGCTTCCTGTCTATGACCGCCCGCGCTGGGGTCGCGCTCGACCCCCCGGTG GACGTCTTTGTGCACCAGAGCAAGCTGCACATGGAAGGGTTCCGAAGCCTCAAGGAGGGTGAGGCGGTGG AGTTCACCTTTAAGAAGTCTGCCAAGGGTCTGGAATCCATCCGTGTCACTGGCCCTGGTGGTGTGTTCTG TATTGGGAGTGAGCGGCGGCCAAAAGGGAAGAACATGCAGAAGCGAAGATCCAAAGGAGACAGGTGCTAC AACTGCGGTGGGCTAGACCATCATGCCAAGGAATGCAAGCTGCCACCCCAGCCCAAGAAGTGCCACTTTT GCCAAAGCATCAACCATATGGTGGCCTCGTGTCCACTGAAGGCCCAGCAGGGCCCCAGTTCTCAGGGAAA GCCTGCCTACTTCCGGGAGGAAGAGGAAGAGATCCACAGCCCTGCCCTGCTCCCAGAAGCCCAGAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR202250 representing NM_145833
Red=Cloning site Green=Tags(s) MGSVSNQQFAGGCAKAAEKAPEEAPPDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPV DVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKNMQKRRSKGDRCY NCGGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQQGPSSQGKPAYFREEEEEIHSPALLPEAQN myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_145833 |
ORF Size | 627 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_145833.1, NP_665832.1 |
RefSeq Size | 3480 bp |
RefSeq ORF | 630 bp |
Locus ID | 83557 |
UniProt ID | Q8K3Y3 |
MW | 23.2 kDa |
Gene Summary | RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed:17473174, PubMed:18604195, PubMed:18566191, PubMed:18292307, PubMed:19703396, PubMed:23102813, PubMed:24209617). Seems to recognize a common structural G-quartet (G4) feature in its miRNA and mRNA targets (PubMed:26045559). 'Translational enhancer' that drives specific mRNAs to polysomes and increases the efficiency of protein synthesis. Its association with the translational machinery and target mRNAs results in an increased number of initiation events per molecule of mRNA and, indirectly, in mRNA stabilization. Binds IGF2 mRNA, MYOD1 mRNA, ARBP/36B4 ribosomal protein mRNA and its own mRNA. Essential for skeletal muscle differentiation program through the translational up-regulation of IGF2 expression (PubMed:17473174). Suppressor of microRNA (miRNA) biogenesis, including that of let-7, miR107, miR-143 and miR-200c. Specifically binds the miRNA precursors (pre-miRNAs), recognizing an 5'-GGAG-3' motif found in pre-miRNA terminal loop, and recruits TUT4 and TUT7 uridylyltransferaseS. This results in the terminal uridylation of target pre-miRNAs. Uridylated pre-miRNAs fail to be processed by Dicer and undergo degradation. The repression of let-7 expression is required for normal development and contributes to maintain the pluripotent state by preventing let-7-mediated differentiation of embryonic stem cells (PubMed:19703396, PubMed:28671666). Localized to the periendoplasmic reticulum area, binds to a large number of spliced mRNAs and inhibits the translation of mRNAs destined for the ER, reducing the synthesis of transmembrane proteins, ER or Golgi lumen proteins, and secretory proteins (PubMed:23102813). Binds to and enhances the translation of mRNAs for several metabolic enzymes, such as PFKP, PDHA1 or SDHA, increasing glycolysis and oxidative phosphorylation. Which, with the let-7 repression may enhance tissue repair in adult tissue (PubMed:24209617).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Dppa3 is critical for Lin28a-regulated ES cells naïve‒primed state conversion
,Sang, H;Wang, D;Zhao, S;Zhang, J;Zhang, Y;Xu, J;Chen, X;Nie, Y;Zhang, K;Zhang, S;Wang, Y;Wang, N;Ma, F;Shuai, L;Li, Z;Liu, N;,
J Mol Cell Biol
,PubMed ID 30481289
[LIN28A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204860 | Lin28a (untagged) - Mouse lin-28 homolog A (Lin28a), (10ug) |
CNY 2,400.00 |
|
MG202250 | Lin28a (tGFP-tagged) - Mouse lin-28 homolog (Lin28) |
CNY 2,850.00 |
|
MR202250L3 | Lenti ORF clone of Lin28a (Myc-DDK-tagged) - Mouse lin-28 homolog A (Lin28a) |
CNY 4,800.00 |
|
MR202250L4 | Lenti ORF clone of Lin28a (mGFP-tagged) - Mouse lin-28 homolog A (Lin28a) |
CNY 4,800.00 |