Dnajb9 (NM_013760) Mouse Tagged ORF Clone

CAT#: MR202557

  • TrueORF®

Dnajb9 (Myc-DDK-tagged) - Mouse DnaJ (Hsp40) homolog, subfamily B, member 9 (Dnajb9)

ORF Plasmid: DDK tGFP



  "NM_013760" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AA408011; AA673251; AA673481; AW556981; ERdj4; Mdg1; mDj7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202557 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACTCCACAGTCAGTTTTCGTCTTTGCAATCTGCATTTTAATGATAACAGAATTAATCCTGGCCT
CCAAAAGCTACTATGATATCTTAGGTGTGCCAAAGTCTGCCTCAGAGCGACAAATCAAAAAGGCCTTTCA
CAAATTAGCCATGAAGTACCACCCTGACAAAAATAAAAGCCCTGATGCTGAAGCAAAATTCAGAGAGATT
GCAGAAGCGTATGAAACACTCTCGGATGCCAATAGTCGGAAAGAGTATGACACAATTGGACACAGTGCTT
TTACCAATGGCAAAGGACAAAGAGGCAATGGGAGTCCTTTTGAACAGTCATTTAACTTCAATTTTGATGA
CTTATTTAAAGACTTTAATTTTTTTGGTCAGAACCAAAACACTCGGTCTAAGAAGCATTTTGAAAACCAC
TTCCACACACGCCAGGATGGTTCTAGTAGACAAAGGCATCACTTCCAGGAGTTTTCTTTTGGAGGCGGAT
TGTTTGATGATATGTTTGAAGACATGGAGAAAATGTTTTCTTTTAGTGGCTTTGATACCACCAATCGACA
CACAGTACAGACTGAAAATAGATTTCATGGATCTAGCAAGCACTGCAGGACTGTCACTCAACGAAGAGGA
AATATGGTTACTACATACACTGATTGTTCAGGACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202557 protein sequence
Red=Cloning site Green=Tags(s)

MATPQSVFVFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREI
AEAYETLSDANSRKEYDTIGHSAFTNGKGQRGNGSPFEQSFNFNFDDLFKDFNFFGQNQNTRSKKHFENH
FHTRQDGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDTTNRHTVQTENRFHGSSKHCRTVTQRRG
NMVTTYTDCSGQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013760
ORF Size 669 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013760.4, NP_038788.2
RefSeq Size 1865 bp
RefSeq ORF 669 bp
Locus ID 27362
UniProt ID Q9QYI6
MW 25.6 kDa
Gene Summary Co-chaperone for Hsp70 protein HSPA5/BiP that acts as a key repressor of the ERN1/IRE1-mediated unfolded protein response (UPR) (By similarity). J domain-containing co-chaperones stimulate the ATPase activity of Hsp70 proteins and are required for efficient substrate recognition by Hsp70 proteins (PubMed:11836248). In the unstressed endoplasmic reticulum, interacts with the luminal region of ERN1/IRE1 and selectively recruits HSPA5/BiP: HSPA5/BiP disrupts the dimerization of the active ERN1/IRE1 luminal region, thereby inactivating ERN1/IRE1 (By similarity). Also involved in endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins (PubMed:22267725). Required for survival of B-cell progenitors and normal antibody production (PubMed:25222125).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...