Rad51l1 (BC058184) Mouse Tagged ORF Clone

CAT#: MR203142

  • TrueORF®

Rad51l1 (Myc-DDK-tagged) - Mouse RAD51-like 1 (S. cerevisiae) (cDNA clone MGC:67754 IMAGE:5322190)

ORF Plasmid: DDK tGFP



  "BC058184" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,470.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms R51H2, mREC2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203142 representing BC058184
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTGAGATTACAGGTCCACCAGGTTGCGGAAAAACTCAGTTTTGCATAATGATGAGTGTCTTAGCTA
CATTACCCACCAGCCTGGGAGGATTAGAAGGGGCTGTGGTCTACATCGACACAGAGTCTGCATTTACTGC
TGAGAGACTGGTTGAGATTGCGGAATCTCGTTTTCCACAATATTTTAACACTGAGGAAAAATTGCTTCTG
ACCAGCAGTAGAGTTCATCTTTGCCGAGAGCTCACCTGTGAGGGGCTTCTACAAAGGCTTGAGTCTTTGG
AGGAAGAGATCATTTCGAAAGGAGTTAAGCTTGTGATTGTTGACTCCATTGCTTCTGTGGTCAGAAAGGA
GTTTGACCCGAAGCTTCAAGGCAACATCAAAGAAAGGAACAAGTTCTTGGGCAAAGGAGCGTCCTTACTG
AAGTACCTGGCAGGGGAGTTTTCAATCCCAGTTATCTTGACGAATCAAATTACGACCCATCTGAGTGGAG
CCCTCCCTTCTCAAGCAGACCTGGTGTCTCCAGCTGATGATTTGTCCCTGTCTGAAGGCACTTCTGGATC
CAGCTGTTTGGTAGCTGCACTAGGAAACACATGGGGTCACTGTGTGAACACCCGGCTGATTCTCCAGTAC
CTTGATTCAGAGAGAAGGCAGATTCTCATTGCCAAGTCTCCTCTGGCTGCCTTCACCTCCTTTGTCTACA
CCATCAAGGGGGAAGGCCTGGTTCTTCAAGGCCACGAAAGACCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203142 representing BC058184
Red=Cloning site Green=Tags(s)

MTEITGPPGCGKTQFCIMMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLL
TSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLL
KYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQY
LDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC058184
ORF Size 744 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC058184.1
RefSeq Size 1315 bp
RefSeq ORF 746 bp
Locus ID 19363
MW 48.2 kDa
Gene Summary Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. May promote the assembly of presynaptic RAD51 nucleoprotein filaments. Binds single-stranded DNA and double-stranded DNA and has DNA-dependent ATPase activity. Part of the RAD21 paralog protein complex BCDX2 which acts in the BRCA1-BRCA2-dependent HR pathway. Upon DNA damage, BCDX2 acts downstream of BRCA2 recruitment and upstream of RAD51 recruitment. BCDX2 binds predominantly to the intersection of the four duplex arms of the Holliday junction and to junction of replication forks. The BCDX2 complex was originally reported to bind single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. The BCDX2 subcomplex RAD51B:RAD51C exhibits single-stranded DNA-dependent ATPase activity suggesting an involvement in early stages of the HR pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...