Map2k4 (BC029833) Mouse Tagged ORF Clone

CAT#: MR203798

  • TrueORF®

Map2k4 (Myc-DDK-tagged) - Mouse mitogen activated protein kinase kinase 4 (cDNA clone MGC:36532 IMAGE:3962163)

ORF Plasmid: DDK tGFP



  "BC029833" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 6,365.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms MEK4, MKK4, Sek1, JNKK1, PRKMK4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203798 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCACAAACCAAGTGGGCAGATAATGGCAGTTAAAAGAATTCGGTCAACTGTGGATGAAAAAGAAC
AAAAACAACTTCTCATGGATTTGGATGTAGTAATGCGGAGTAGTGATTGCCCATACATTGTTCAGTTCTA
TGGTGCACTCTTCAGAGAGGGCGACTGTTGGATCTGTATGGAGCTCATGTCTACCTCGTTCGATAAGTTT
TACAAATATGTATATAGTGTGTTAGATGACGTTATTCCGGAAGAGATCTTAGGCAAAATCACTTTAGCAA
CTGTGAAAGCACTAAACCACTTAAAAGAAAACTTGAAAATTATTCACAGAGACATCAAACCTTCCAATAT
TCTTCTGGACAGAAGTGGAAATATAAAGCTCTGTGATTTCGGCATCAGTGGACAGCTTGTGGACTCTATT
GCCAAGACAAGAGATGCTGGGTGTAGGCCGTATATGGCACCTGAAAGAATAGACCCAAGTGCATCAAGAC
AAGGGTATGATGTCCGCTCTGATGTCTGGAGTTTGGGGATCACATTGTACGAGTTGGCCACAGGCCGATT
TCCTTATCCAAAGTGGAATAGTGTATTTGATCAGCTAACACAAGTGGTGAAAGGAGACCCTCCGCAGCTG
AGTAATTCTGAAGAAAGGGAGTTCTCCCCCAGTTTCATCAACTTTGTCAACTTGTGCCTTACGAAGGATG
AATCCAAAAGGCCAAAGTATAAAGAGCTTCTGAAACATCCCTTTATTTTGATGTATGAAGAACGTACTGT
AGAGGTCGCATGCTATGTTTGTAAAATCCTGGATCAGATGCCAGCCACTCCCAGCTCGCCCATGTATGTC
GAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203798 protein sequence
Red=Cloning site Green=Tags(s)

MVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKF
YKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSI
AKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQL
SNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYV
D

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC029833
ORF Size 843 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC029833, AAH29833
RefSeq Size 2373 bp
RefSeq ORF 845 bp
Locus ID 26398
MW 32.2 kDa
Gene Summary Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7, is the one of the only known kinase to directly activate the stress-activated protein kinase/c-Jun N-terminal kinases MAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 and MAP2K7/MKK7 both activate the JNKs by phosphorylation, but they differ in their preference for the phosphorylation site in the Thr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation of the Tyr residue and MAP2K7/MKK7 for the Thr residue. The phosphorylation of the Thr residue by MAP2K7/MKK7 seems to be the prerequisite for JNK activation at least in response to proinflammatory cytokines, while other stimuli activate both MAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylate JNKs. MAP2K4 is required for maintaining peripheral lymphoid homeostasis. The MKK/JNK signaling pathway is also involved in mitochondrial death signaling pathway, including the release cytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7 exclusively activates JNKs, MAP2K4/MKK4 additionally activates the p38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...