Dclk1 (NM_001195540) Mouse Tagged ORF Clone
CAT#: MR226416
- TrueORF®
Dclk1 (Myc-DDK-tagged) - Mouse doublecortin-like kinase 1 (Dclk1), transcript variant 7
ORF Plasmid: tGFP
"NM_001195540" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,900.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 1700113D08Rik; 2810480F11Rik; AI836758; Clic; Click-I; CPG1; Cpg16; Dc; Dcamk; Dcamkl1; Dcl; Dclk; mKIAA0369 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR226416 representing NM_001195540
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTAGAGCTCATAGAAGTTAATGGAACCCCTGGTAGTCAGCTCTCTACTCCACGCTCGGGCAAGTCAC CAAGTCCATCACCCACCAGCCCAGGAAGCCTGCGGAAGCAGAGGGACCTGTACCGCCCCCTCTCGTCGGA TGATTTGGACTCAGTAGGAGACTCAGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR226416 representing NM_001195540
Red=Cloning site Green=Tags(s) MLELIEVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRDLYRPLSSDDLDSVGDSV myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001195540 |
ORF Size | 168 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001195540.2 |
RefSeq Size | 5175 bp |
RefSeq ORF | 171 bp |
Locus ID | 13175 |
MW | 6.4 kDa |
Gene Summary | This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been found, but the biological validity of some variants has not been determined. These variants encode different isoforms, which are differentially expressed and have different kinase activities. [provided by RefSeq, Sep 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208367 | Dclk1 (untagged) - Mouse doublecortin-like kinase 1 (Dclk1), transcript variant 7, (10ug) |
CNY 3,990.00 |
|
MG226416 | Dclk1 (tGFP-tagged) - Mouse doublecortin-like kinase 1 (Dclk1) transcript variant 7, (10ug) |
CNY 2,090.00 |
|
MR226416L3 | Lenti ORF clone of Dclk1 (Myc-DDK-tagged) - Mouse doublecortin-like kinase 1 (Dclk1), transcript variant 7 |
CNY 3,800.00 |
|
MR226416L4 | Lenti ORF clone of Dclk1 (mGFP-tagged) - Mouse doublecortin-like kinase 1 (Dclk1), transcript variant 7 |
CNY 3,800.00 |