Dlx5 (NM_198854) Mouse Tagged ORF Clone

CAT#: MR226753

  • TrueORF®

Dlx5 (Myc-DDK-tagged) - Mouse distal-less homeobox 5 (Dlx5), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_198854" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,200.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI385752
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR226753 representing NM_198854
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGGAGTGTTTGACAGAAGAGTCCCAAGCATCCGATCCGGCGACTTCCAAGCTCCGTTCCCGACGT
CCGCCGCCATGCACCACCCGTCTCAGGAATCGCCAACTTTGCCCGAGTCCTCGGCCACCGATTCTGACTA
CTACAGTCCCGCGGGGGCCGCCCCGCACGGCTACTGCTCTCCTACCTCTGCTTCTTATGGCAAAGCGCTC
AACCCCTACCAGTACCAGTACCACGGCGTGAACGGCTCCGCAGCCGGCTACCCGGCCAAGGCTTATGCCG
ACTACGGCTACGCCAGCCCCTACCACCAGTACGGCGGCGCCTACAACCGCGTCCCGAGTGCCACCAGCCA
GCCAGCTTTCAGCTGGCCGCTTTACAGAGAAGGTTTCAGAAGACTCAGTACCTCGCCCTGCCAGAACGCG
CGGAGTTGGCCGCCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226753 representing NM_198854
Red=Cloning site Green=Tags(s)

MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKAL
NPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPAFSWPLYREGFRRLSTSPCQNA
RSWPPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_198854
ORF Size 438 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_198854.2, NP_942151.1
RefSeq Size 1349 bp
RefSeq ORF 441 bp
Locus ID 13395
UniProt ID P70396
MW 16.3 kDa
Gene Summary Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...