Mpz (NM_008623) Mouse Tagged ORF Clone

CAT#: MR227005

  • TrueORF®

Mpz (Myc-DDK-tagged) - Mouse myelin protein zero (Mpz)

ORF Plasmid: DDK tGFP



  "NM_008623" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 3,600.00


货期*
现货

规格
    • 10 ug

Cited in 1 publication.

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms M; Mpp; P; P-zero; P0
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227005 representing NM_008623
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCCGGGGCTCCCTCCTCCAGCCCCAGCCCTATCCTGGCTGCCCTGCTCTTCTCTTCTTTGGTGC
TCTCTCCAGCCCTGGCCATTGTGGTTTACACGGACAGGGAAATCTATGGTGCCGTGGGCTCCCAGGTGAC
CCTGCACTGCTCCTTCTGGTCCAGTGAATGGGTCTCAGATGACATCTCTTTTACCTGGCGCTACCAGCCT
GAAGGGGGCCGAGATGCCATTTCGATCTTCCACTATGCCAAGGGACAACCTTACATCGATGAGGTGGGGA
CCTTCAAAGAGCGCATCCAGTGGGTAGGGGACCCTCGCTGGAAGGATGGCTCCATTGTCATACACAACCT
AGACTACAGTGACAACGGCACTTTCACATGTGATGTCAAAAACCCACCGGACATAGTGGGCAAGACCTCT
CAGGTCACGCTCTATGTCTTTGAAAAAGTGCCCACTAGGTATGGGGTGGTGTTGGGAGCAGTGATCGGGG
GCATCCTCGGGGTGGTGCTGTTGCTGCTGTTGCTCTTCTACCTGATTCGGTACTGCTGGCTGCGCAGGCA
GGCTGCCCTGCAGAGAAGGCTCAGTGCCATGGAGAAGGGGAGATTTCACAAATCTTCGAAGGACTCCTCG
AAGCGAGGGCGGCAGACGCCAGTGCTGTATGCCATGCTGGACCACAGCCGAAGCACCAAAGCTGCCAGTG
AGAAGAAATCAAAAGGGCTGGGGGAGTCTCGCAAGGATAAGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227005 representing NM_008623
Red=Cloning site Green=Tags(s)

MAPGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQP
EGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTS
QVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSS
KRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008623
ORF Size 744 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008623.5, NP_032649.2
RefSeq Size 1993 bp
RefSeq ORF 747 bp
Locus ID 17528
UniProt ID P27573
MW 28.1 kDa
Gene Summary This gene is specifically expressed in Schwann cells of the peripheral nervous system and encodes a type I transmembrane glycoprotein that is a major structural protein of the peripheral myelin sheath. The encoded protein contains a large hydrophobic extracellular domain and a smaller basic intracellular domain, which are essential for the formation and stabilization of the multilamellar structure of the compact myelin. Mutations in the orthologous gene in human are associated with myelinating neuropathies. A recent study showed that two isoforms are produced from the same mRNA by use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. Alternatively spliced transcript variants have also been found for this gene. [provided by RefSeq, Oct 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Other Versions

Customer Reviews 
Loading...