Sirt6 (NM_001163430) Mouse Tagged ORF Clone

CAT#: MR227518

  • TrueORF®

Sirt6 (Myc-DDK-tagged) - Mouse sirtuin 6 (silent mating type information regulation 2, homolog) 6 (S. cerevisiae) (Sirt6), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001163430" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,950.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


SIRT6 Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

热销推荐

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 2810449N18Rik; AI043036; Sir2l6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227518 representing NM_001163430
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGCAGTCCTCCAGCGTGGTTTTCCACACGGGCGCCGGCATCAGCACCGCCTCTGGCATCCCCGACT
TCAGAGGCCCCCATGGCGTGTGGACCATGGAGGAACGCGGCCTGGCCCCCAAGTTTGACACCACCTTCGA
GAATGCTCGGCCCTCGAAGACCCACATGGCCCTGGTTCAGCTAGAACGCATGGGCTTCCTCAGCTTCCTG
GTCAGCCAGAACGTAGACGGGCTGCACGTGCGCTCGGGCTTCCCCAGGGACAAGCTGGCAGAGCTGCACG
GAAACATGTTTGTAGAGGAATGTCCCAAGTGTAAGACGCAGTACGTCAGAGACACGGTTGTGGGCACCAT
GGGCCTCAAGGCCACAGGCCGGCTCTGCACCGTGGCCAAGACCAGGGGACTTCGGGCCTGTAGAGGGGAG
CTGAGAGACACCATTCTGGACTGGGAGGACTCGTTGCCTGACCGGGACCTGATGCTCGCTGATGAGGCCA
GCAGGACCGCAGACCTGTCTGTCACCCTGGGTACCTCGCTGCAGATCCGCCCCAGTGGGAACCTGCCCCT
TGCCACTAAGCGCCGAGGAGGCCGTCTGGTCATTGTCAACCTGCAACCCACAAAACATGACCGCCAGGCT
GACCTGCGCATCCACGGCTACGTGGATGAGGTGATGTGCAGACTCATGAAGCATCTGGGGCTGGAGATTC
CAGCCTGGGATGGACCCTGCGTGCTAGACAAAGCCCTGCCACCTCTGCCTCGCCCAGTAGCACTCAAGGC
TGAGCCCCCCGTGCATCTCAATGGTGCAGTGCATGTTTCGTATAAGTCCAAGCCCAACAGCCCTATACTC
CACAGGCCCCCCAAAAGAGTGAAGACCGAGGCTGCCCCCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227518 representing NM_001163430
Red=Cloning site Green=Tags(s)

MWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFENARPSKTHMALVQLERMGFLSFL
VSQNVDGLHVRSGFPRDKLAELHGNMFVEECPKCKTQYVRDTVVGTMGLKATGRLCTVAKTRGLRACRGE
LRDTILDWEDSLPDRDLMLADEASRTADLSVTLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRQA
DLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPIL
HRPPKRVKTEAAPS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001163430
ORF Size 882 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001163430.2
RefSeq Size 1668 bp
RefSeq ORF 885 bp
Locus ID 50721
MW 32.9 kDa
Gene Summary NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Deacetylation of nucleosomes interferes with RELA binding to target DNA. May be required for the association of WRN with telomeres during S-phase and for normal telomere maintenance. On DNA damage, promotes DNA end resection via deacetylation of RBBP8. Has very weak deacetylase activity and can bind NAD(+) in the absence of acetylated substrate (By similarity). Acts as a corepressor of the transcription factor Hif1a to control the expression of multiple glycolytic genes to regulate glucose homeostasis. Required for genomic stability. Required for normal IGF1 serum levels and normal glucose homeostasis. Modulates cellular senescence and apoptosis. Regulates the production of TNF protein. Has a role in the regulation of life span in male mice, but not in female mice.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...