Prkcz (NM_001039079) Mouse Tagged ORF Clone

CAT#: MR227625

  • TrueORF®

Prkcz (Myc-DDK-tagged) - Mouse protein kinase C, zeta (Prkcz), transcript variant 2

ORF Plasmid: DDK tGFP



  "NM_001039079" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,488.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms AI098070; aPKCzeta; C80388; nPKC-zeta; Pkcz; R74924; zetaPKC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227625 representing NM_001039079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCTGTCATGCCTTCCCAAGAGCCTCCAGTAGATGACAAGAACGATGGTGTAGACCTTCCTTCAG
AAGAAACTGATGGAATTGCTTATATTTCTTCATCTCGGAAACATGATAATATCAAAGATGATTCTGAGGA
CCTTAAGCCTGTCATCGATGGGGTGGATGGGATCAAAATCTCTCAGGGGCTGGGGCTGCAAGACTTCGAC
CTCATCAGAGTCATCGGGCGTGGAAGCTATGCCAAGGTCCTCCTGGTGCGGTTGAAGAAAAACGACCAGA
TTTACGCCATGAAGGTGGTAAAGAAGGAGCTTGTCCACGACGACGAGGATATCGACTGGGTGCAGACAGA
GAAACATGTGTTTGAGCAGGCGTCCAGCAACCCCTTCCTGGTTGGCTTACACTCCTGCTTCCAGACAACG
AGCCGGTTGTTCCTGGTCATCGAGTATGTCAATGGCGGGGACCTCATGTTCCACATGCAGAGGCAGAGAA
AACTTCCAGAGGAGCATGCCAGGTTCTATGCTGCTGAGATCTGTATCGCTCTCAACTTCTTGCATGAGAG
GGGGATCATCTACCGGGACCTAAAACTGGACAACGTCCTCCTTGATGCCGACGGACACATTAAGCTGACG
GACTACGGCATGTGCAAGGAAGGTCTAGGCCCCGGTGATACAACAAGCACTTTTTGTGGAACCCCGAACT
ATATCGCCCCCGAAATCCTGCGAGGAGAAGAGTACGGGTTCAGCGTGGACTGGTGGGCACTGGGTGTCCT
TATGTTTGAGATGATGGCTGGGCGCTCCCCCTTTGACATCATCACGGACAACCCTGACATGAACACTGAA
GACTACCTTTTCCAAGTTATCCTGGAAAAGCCAATCCGGATTCCCCGTTTCCTGTCTGTCAAGGCCTCAC
ACGTCTTAAAAGGATTTTTAAATAAGGATCCCAAAGAGAGGCTTGGCTGCCGGCCACAGACTGGGTTTTC
CGACATCAAGTCTCATGCTTTCTTCCGCAGCATAGACTGGGACCTGCTGGAAAAGAAGCAGACCCTGCCT
CCCTTCCAGCCCCAGATCACAGATGACTATGGCCTGGACAACTTTGACACGCAGTTCACCAGCGAGCCTG
TGCAGCTGACCCCAGATGATGAGGACGTCATAAAGAGGATCGACCAGTCCGAATTTGAAGGCTTTGAGTA
CATCAACCCACTTCTGCTGTCTGCTGAGGAGTCCGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227625 representing NM_001039079
Red=Cloning site Green=Tags(s)

MDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDGIKISQGLGLQDFD
LIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTT
SRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLT
DYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTE
DYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLP
PFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001039079
ORF Size 1227 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001039079.2, NP_001034168.1
RefSeq Size 4103 bp
RefSeq ORF 1230 bp
Locus ID 18762
MW 47.1 kDa
Gene Summary Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response and maintenance of long-term potentiation (LTP). Upon lipopolysaccharide (LPS) treatment in macrophages, or following mitogenic stimuli, functions downstream of PI3K to activate MAP2K1/MEK1-MAPK1/ERK2 signaling cascade independently of RAF1 activation. Required for insulin-dependent activation of AKT3, but may function as an adapter rather than a direct activator. Upon insulin treatment may act as a downstream effector of PI3K and contribute to the activation of translocation of the glucose transporter SLC2A4/GLUT4 and subsequent glucose transport in adipocytes. In EGF-induced cells, binds and activates MAP2K5/MEK5-MAPK7/ERK5 independently of its kinase activity and can activate JUN promoter through MEF2C. Through binding with SQSTM1/p62, functions in interleukin-1 signaling and activation of NF-kappa-B with the specific adapters RIPK1 and TRAF6. Participates in TNF-dependent transactivation of NF-kappa-B by phosphorylating and activating IKBKB kinase, which in turn leads to the degradation of NF-kappa-B inhibitors. In migrating astrocytes, forms a cytoplasmic complex with PARD6A and is recruited by CDC42 to function in the establishment of cell polarity along with the microtubule motor and dynein. In association with FEZ1, stimulates neuronal differentiation in PC12 cells. In the inflammatory response, is required for the T-helper 2 (Th2) differentiation process, including interleukin production, efficient activation of JAK1 and the subsequent phosphorylation and nuclear translocation of STAT6. May be involved in development of allergic airway inflammation (asthma), a process dependent on Th2 immune response. In the NF-kappa-B-mediated inflammatory response, can relieve SETD6-dependent repression of NF-kappa-B target genes by phosphorylating the RELA subunit at 'Ser-311'. In vein endothelial cells treated with the oxidant peroxynitrite, phosphorylates STK11 leading to nuclear export of STK11, subsequent inhibition of PI3K/Akt signaling, and increased apoptosis. Phosphorylates VAMP2 in vitro (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...