Rab13 (NM_001293741) Mouse Tagged ORF Clone
CAT#: MR227953
- TrueORF®
Rab13 (myc-DDK-tagged) - Mouse RAB13, member RAS oncogene family (Rab13), transcript variant 2
"NM_001293741" in other vectors (1)
Need custom modification / cloning service?
Get a free quote
CNY 1,900.00
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 0610007N03Rik; B230212B15Rik |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR227953 representing NM_001293741
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGCATTATCCTCGTATATGACATCACAGATGAGAAATCCTTCGAGAATATTCAGAACTGGATGAAAA GCATCAAAGAGAATGCCTCTGCGGGAGTGGAGCGCCTCCTGCTGGGAAACAAGTGTGACATGGAGGCCAA GCGGCAGGTGCAGAGAGAGCAGGCGGAGAAGTTGGCTCGAGAGCACAGAATCCGATTTTTTGAGACGAGT GCCAAATCCAGTGTGAATGTGGATGAGGCTTTCAGTTCCCTGGCCCGTGACATCTTGCTCAAGACAGGAG GCCGGAGATCGGGAACCAACAGTAAGCCCTCAAGCACTGGCCTGAAAACATCTGACAAGAAGAAGAACAA GTGCTTGTTAGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR227953 representing NM_001293741
Red=Cloning site Green=Tags(s) MGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETS AKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNKCLLG myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001293741 |
ORF Size | 363 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001293741.1, NP_001280670.1 |
RefSeq Size | 1417 bp |
RefSeq ORF | 366 bp |
Locus ID | 68328 |
MW | 14 kDa |
Gene Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC225742 | Rab13 (untagged) - Mouse RAB13, member RAS oncogene family (Rab13), transcript variant 2 |
CNY 2,000.00 |