Ube2w (NM_001271017) Mouse Tagged ORF Clone

CAT#: MR228214

  • TrueORF®

Ube2w (myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2W (putative) (Ube2w), transcript variant 3



  "NM_001271017" in other vectors (1)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 1,900.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 6130401J04Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228214 representing NM_001271017
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGCCCCCGCGGCGTGACGCGAGCACGGCGGCTCCGCCCCCTGCGTCTCGGGCCTCGCTGGCCTT
GGGGGGATGGTTTCATCATGGCGTCAATGCAGAAACGACTACAAAAAGAACTGTTGGCTTTGCAGAATGA
CCCACCTCCTGGAATGACTTTAAATGAAAAGAGTGTTCAGAATTCAATCACGCAGTGGATCGTAGACATG
GAAGGTGCACCAGGAACCTTATATGAAGGGGAAAAATTTCAACTTTTGTTTAAATTTAGTAGTCGATACC
CTTTTGACTCTCCTCAGAAGACTGGTCCCCGGCGCTCTCAGTGCAGTCAGTCTGTCTCAGCATTATCAGC
ATGCTTTCCAGCTGCAAAGAAAAGAGACGACCACCAGATAATTCCTTTTATGTGCGAACATGTAACAAGA
ATCCAAAGAAAACAAAATGGTGGTATCATGATGACACTTGTTGATGCCGCTGCCCTCCTCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228214 representing NM_001271017
Red=Cloning site Green=Tags(s)

MLGPRGVTRARRLRPLRLGPRWPWGDGFIMASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDM
EGAPGTLYEGEKFQLLFKFSSRYPFDSPQKTGPRRSQCSQSVSALSACFPAAKKRDDHQIIPFMCEHVTR
IQRKQNGGIMMTLVDAAALLL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271017
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001271017.1, NP_001257946.1
RefSeq Size 3060 bp
RefSeq ORF 486 bp
Locus ID 66799
MW 18.6 kDa
Gene Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini (PubMed:21855799, PubMed:21229326). Involved in degradation of misfolded chaperone substrates by mediating monoubiquitination of STUB1/CHIP, leading to recruitment of ATXN3 to monoubiquitinated STUB1/CHIP, and restriction of the length of ubiquitin chain attached to STUB1/CHIP substrates by ATXN3 (PubMed:21855799). After UV irradiation, but not after mitomycin-C (MMC) treatment, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway (PubMed:21229326). In vitro catalyzes 'Lys-11'-linked polyubiquitination. UBE2W-catalyzed ubiquitination occurs also in the presence of inactive RING/U-box type E3s, i.e. lacking the active site cysteine residues to form thioester bonds with ubiquitin, or even in the absence of E3, albeit at a slower rate (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...