United States
Germany
Japan
United Kingdom
China
HSP27 (HSPB1) (NM_001540) Human Tagged ORF Clone
CAT＃: RC201800
HSPB1 (Myc-DDK-tagged)-Human heat shock 27kDa protein 1 (HSPB1)
ORF Plasmid: tGFP
"NM_001540" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
| Cited in 5 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 3,600.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | CMT2F; HEL-S-102; HMN2B; HS.76067; Hsp25; HSP27; HSP28; SRP27 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC201800 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACCGAGCGCCGCGTCCCCTTCTCGCTCCTGCGGGGCCCCAGCTGGGACCCCTTCCGCGACTGGTACC CGCATAGCCGCCTCTTCGACCAGGCCTTCGGGCTGCCCCGGCTGCCGGAGGAGTGGTCGCAGTGGTTAGG CGGCAGCAGCTGGCCAGGCTACGTGCGCCCCCTGCCCCCCGCCGCCATCGAGAGCCCCGCAGTGGCCGCG CCCGCCTACAGCCGCGCGCTCAGCCGGCAACTCAGCAGCGGGGTCTCGGAGATCCGGCACACTGCGGACC GCTGGCGCGTGTCCCTGGATGTCAACCACTTCGCCCCGGACGAGCTGACGGTCAAGACCAAGGATGGCGT GGTGGAGATCACCGGCAAGCACGAGGAGCGGCAGGACGAGCATGGCTACATCTCCCGGTGCTTCACGCGG AAATACACGCTGCCCCCCGGTGTGGACCCCACCCAAGTTTCCTCCTCCCTGTCCCCTGAGGGCACACTGA CCGTGGAGGCCCCCATGCCCAAGCTAGCCACGCAGTCCAACGAGATCACCATCCCAGTCACCTTCGAGTC GCGGGCCCAGCTTGGGGGCCCAGAAGCTGCAAAATCCGATGAGACTGCCGCCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC201800 protein sequence
Red=Cloning site Green=Tags(s) MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAA PAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTR KYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_001540 |
| ORF Size | 615 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_001540.5 |
| RefSeq Size | 914 bp |
| RefSeq ORF | 618 bp |
| Locus ID | 3315 |
| UniProt ID | P04792 |
| Domains | HSP20 |
| Protein Pathways | MAPK signaling pathway, VEGF signaling pathway |
| MW | 22.8 kDa |
| Gene Summary | This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy. [provided by RefSeq, Aug 2017] |
Citations (5)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Human HSPB1 mutation recapitulates features of distal hereditary motor neuropathy (dHMN) in Drosophila
,Kang, KH;Han, JE;Hong, YB;Nam, SH;Choi, BO;Koh, H;,
Biochem. Biophys. Res. Commun.
,PubMed ID 31630804
[HSP27]
|
|
microRNA-577 suppresses tumor growth and enhances chemosensitivity in colorectal cancer
,Jiang, H;Ju, H;Zhang, L;Lu, H;Jie, K;,
J. Biochem. Mol. Toxicol
,PubMed ID 28150434
[HSP27]
|
|
热休克蛋白 B1 抑制 HBV 复制的研究
,程胜桃, ;任吉华, ;刘波, ;陈娟, ;,
第三军医大学学报 2016
[HSP27]
|
|
Non-native conformers of CFTR NBD1 are recognized by Hsp27 and conjugated to SUMO-2 for degradation
,Gong, X;Ahner, A;Roldan, A;Lukacs, GL;Thibodeau, PH;Frizzell, RA;,
J. Biol. Chem.
,PubMed ID 26627832
[HSP27]
|
|
Small Heat Shock Protein Beta-1 (HSPB1) Is Upregulated and Regulates Autophagy and Apoptosis of Renal Tubular Cells in Acute Kidney Injury
,Matsumoto, T;Urushido, M;Ide, H;Ishihara, M;Hamada-Ode, K;Shimamura, Y;Ogata, K;Inoue, K;Taniguchi, Y;Taguchi, T;Horino, T;Fujimoto, S;Terada, Y;,
PLoS ONE
,PubMed ID 25962073
[HSP27]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC201800L1 | Lenti ORF clone of Human heat shock 27kDa protein 1 (HSPB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC201800L2 | Lenti ORF clone of Human heat shock 27kDa protein 1 (HSPB1), mGFP tagged |
CNY 5,890.00 |
|
| RC201800L3 | Lenti ORF clone of Human heat shock 27kDa protein 1 (HSPB1), Myc-DDK-tagged |
CNY 6,000.00 |
|
| RC201800L4 | Lenti ORF clone of Human heat shock 27kDa protein 1 (HSPB1), mGFP tagged |
CNY 6,000.00 |
|
| RG201800 | HSPB1 (tGFP-tagged) - Human heat shock 27kDa protein 1 (HSPB1) |
CNY 5,200.00 |
|
| SC319285 | HSPB1 (untagged)-Human heat shock 27kDa protein 1 (HSPB1) |
CNY 3,600.00 |
