United States
Germany
Japan
United Kingdom
China
CXCL14 (NM_004887) Human Tagged ORF Clone
CAT＃: RC202533
- TrueORF®
CXCL14 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14)
ORF Plasmid: tGFP
"NM_004887" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
| Cited in 2 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | BMAC; BRAK; KEC; KS1; MIP-2g; MIP2G; NJAC; SCYB14 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC202533 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCTGCTCCCACGCCGCGCCCCTCCGGTCAGCATGAGGCTCCTGGCGGCCGCGCTGCTCCTGCTGC TGCTGGCGCTGTACACCGCGCGTGTGGACGGGTCCAAATGCAAGTGCTCCCGGAAGGGACCCAAGATCCG CTACAGCGACGTGAAGAAGCTGGAAATGAAGCCAAAGTACCCGCACTGCGAGGAGAAGATGGTTATCATC ACCACCAAGAGCGTGTCCAGGTACCGAGGTCAGGAGCACTGCCTGCACCCCAAGCTGCAGAGCACCAAGC GCTTCATCAAGTGGTACAACGCCTGGAACGAGAAGCGCAGGGTCTACGAAGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC202533 protein sequence
Red=Cloning site Green=Tags(s) MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVII TTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_004887 |
| ORF Size | 333 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_004887.4 |
| RefSeq Size | 1989 bp |
| RefSeq ORF | 300 bp |
| Locus ID | 9547 |
| UniProt ID | O95715 |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
| MW | 13.1 kDa |
| Gene Summary | This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [provided by RefSeq, Sep 2014] |
Citations (2)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Malignant cell-specific CXCL14 promotes tumor lymphocyte infiltration in oral cavity squamous cell carcinoma
,Parikh, A;Shin, J;Faquin, W;Lin, DT;Tirosh, I;Sunwoo, JB;Puram, SV;,
J Immunother Cancer
,PubMed ID 32958684
[CXCL14]
|
|
A Crucial Role of CXCL14 for Promoting Regulatory T Cells Activation in Stroke
,Lee, H-;Liu, SP;Lin, C-;Lee, SW;Hsu, CY;Sytwu, H-;Hsieh, C-;Shyu, W-;,
Theranostics
,PubMed ID 28382159
[CXCL14]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC202533L1 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged |
CNY 4,200.00 |
|
| RC202533L2 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged |
CNY 5,890.00 |
|
| RC202533L3 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), Myc-DDK-tagged |
CNY 4,200.00 |
|
| RC202533L4 | Lenti ORF clone of Human chemokine (C-X-C motif) ligand 14 (CXCL14), mGFP tagged |
CNY 4,200.00 |
|
| RG202533 | CXCL14 (tGFP-tagged) - Human chemokine (C-X-C motif) ligand 14 (CXCL14) |
CNY 3,400.00 |
|
| SC127695 | CXCL14 (untagged)-Human chemokine (C-X-C motif) ligand 14 (CXCL14) |
CNY 1,800.00 |
