CTRB1 (NM_001906) Human Tagged ORF Clone

CAT#: RC202806

CTRB1 (Myc-DDK-tagged)-Human chymotrypsinogen B1 (CTRB1)

ORF Plasmid: DDK tGFP



  "NM_001906" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


CTRB1 Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CTRB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202806 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTCCTCTGGCTCCTCTCCTGCTGGGCCCTCCTGGGTACCACCTTCGGCTGCGGGGTCCCCGCCA
TCCACCCTGTGCTCAGCGGCCTGTCCAGGATCGTGAATGGGGAGGACGCCGTCCCCGGCTCCTGGCCCTG
GCAGGTGTCCCTGCAGGACAAAACCGGCTTCCACTTCTGCGGGGGCTCCCTCATCAGCGAGGACTGGGTG
GTCACCGCTGCCCACTGCGGGGTCAGGACCTCCGACGTGGTCGTGGCTGGGGAGTTTGACCAGGGCTCTG
ACGAGGAGAACATCCAGGTCCTGAAGATCGCCAAGGTCTTCAAGAACCCCAAGTTCAGCATTCTGACCGT
GAACAATGACATCACCCTGCTGAAGCTGGCCACACCTGCCCGCTTCTCCCAGACAGTGTCCGCCGTGTGC
CTGCCCAGCGCCGACGACGACTTCCCCGCGGGGACACTGTGTGCCACCACAGGCTGGGGCAAGACCAAGT
ACAACGCCAACAAGACCCCTGACAAGCTGCAGCAGGCAGCCCTGCCCCTCCTGTCCAATGCCGAATGCAA
GAAGTCCTGGGGCAGGAGGATCACCGACGTGATGATCTGTGCCGGGGCCAGTGGCGTCTCCTCCTGCATG
GGCGACTCTGGCGGTCCCCTGGTCTGCCAAAAGGATGGAGCCTGGACCCTGGTGGGCATTGTGTCCTGGG
GCAGCGACACCTGCTCCACCTCCAGCCCTGGCGTGTACGCCCGTGTCACCAAGCTCATACCTTGGGTGCA
GAAGATCCTGGCTGCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202806 protein sequence
Red=Cloning site Green=Tags(s)

MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV
VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC
LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM
GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001906
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_001906.3
RefSeq Size 873 bp
RefSeq ORF 792 bp
Locus ID 1504
UniProt ID P17538
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
MW 27.9 kDa
Gene Summary This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This CTRB1 gene is located head-to-head with the related CTRB2 gene. Some human populations have an alternate haplotype which inverts a 16.6 Kb region containing portions of intron 1, exon 1, and the upstream sequence of the CTRB1 and CTRB2 genes. In this inversion haplotype exon 1 and flanking sequence is swapped in CTRB1 and CTRB2. This inversion is associated with differential gene expression and increased risk for chronic pancreatitis. The GRCh38 assembly represents the minor allele for SNP rs8048956 of the CTRB1 gene. SNP rs8048956 in intron 1 of the CTRB2 gene is diagnostic for this inversion. This CTRB1 gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jan 2021]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...