SAP30L (NM_024632) Human Tagged ORF Clone

CAT#: RC203405

SAP30L (Myc-DDK-tagged)-Human SAP30-like (SAP30L), transcript variant 1

ORF Plasmid: DDK tGFP



  "NM_024632" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


SAP30L rabbit polyclonal antibody
    • 25 ul

CNY 800.00
CNY 1,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms NS4ATP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203405 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGGCTTCAGCACGGAGGAGGACAGCCGCGAAGGGCCCCCCGCCGCCCCAGCTGCCGCCGCCCCGG
GCTACGGCCAGAGCTGCTGCCTCATCGAGGACGGCGAGCGCTGCGTCCGGCCCGCGGGCAACGCCTCCTT
CAGCAAGAGGGTCCAGAAGAGCATCTCGCAGAAGAAACTCAAGCTGGACATCGACAAGAGCGTAAGGCAC
CTATATATCTGTGATTTTCACAAAAATTTCATCCAGAGTGTCCGAAATAAAAGGAAGAGGAAGACAAGTG
ACGATGGCGGAGATTCTCCCGAGCACGACACTGACATTCCTGAGGTTGATCTGTTCCAGCTGCAGGTGAA
CACCCTACGACGTTATAAACGACACTACAAGTTGCAGACCAGACCAGGCTTCAATAAGGCCCAGTTAGCA
GAAACTGTGAGTCGACACTTCAGGAACATACCTGTGAATGAAAAAGAGACCCTTGCCTACTTCATCTACA
TGGTGAAGAGTAACAAGAGTAGACTGGACCAGAAATCGGAGGGTGGCAAGCAGCTTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203405 protein sequence
Red=Cloning site Green=Tags(s)

MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRH
LYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLA
ETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024632
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_024632.6
RefSeq Size 6243 bp
RefSeq ORF 552 bp
Locus ID 79685
UniProt ID Q9HAJ7
MW 20.9 kDa
Gene Summary Isoform 1: Functions as transcription repressor, probably via its interaction with histone deacetylase complexes (PubMed:16820529, PubMed:18070604). Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC) to the nucleolus (PubMed:16820529). Binds DNA, apparently without sequence-specificity, and bends bound double-stranded DNA (PubMed:19015240). Binds phosphoinositol phosphates (phosphoinositol 3-phosphate, phosphoinositol 4-phosphate and phosphoinositol 5-phosphate) via the same basic sequence motif that mediates DNA binding and nuclear import (PubMed:19015240, PubMed:26609676).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...