RGS10 (NM_001005339) Human Tagged ORF Clone
CAT#: RC203488
RGS10 (Myc-DDK-tagged)-Human regulator of G-protein signaling 10 (RGS10), transcript variant 1
ORF Plasmid: tGFP
"NM_001005339" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 3,705.00
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203488 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTCAACCGCGCCGTGAGCCGGCTGAGCAGGAAGCGGCCGCCGTCAGACATCCACGACAGCGATGGCA GTTCCAGCAGCAGCCACCAGAGCCTCAAGAGCACAGCCAAATGGGCGGCATCCCTGGAGAATCTGCTGGA AGACCCAGAAGGCGTGAAAAGATTTAGGGAATTTTTAAAAAAGGAATTCAGTGAAGAAAATGTTTTGTTT TGGCTAGCATGTGAAGATTTTAAGAAAATGCAAGATAAGACGCAGATGCAGGAAAAGGCAAAGGAGATCT ACATGACCTTTCTGTCCAGCAAGGCCTCATCACAGGTCAACGTGGAGGGGCAGTCTCGGCTCAACGAGAA GATCCTGGAAGAACCGCACCCTCTGATGTTCCAGAAACTCCAGGACCAGATCTTTAATCTCATGAAGTAC GACAGCTACAGCCGCTTCTTAAAGTCTGACTTGTTTTTAAAACACAAGCGAACCGAGGAAGAGGAAGAAG ATTTGCCTGATGCTCAAACTGCAGCTAAAAGAGCTTCCAGAATTTATAACACA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203488 protein sequence
Red=Cloning site Green=Tags(s) MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLF WLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKY DSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001005339 |
ORF Size | 543 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001005339.2 |
RefSeq Size | 910 bp |
RefSeq ORF | 546 bp |
Locus ID | 6001 |
UniProt ID | O43665 |
MW | 21.2 kDa |
Gene Summary | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203488L1 | Lenti ORF clone of Human regulator of G-protein signaling 10 (RGS10), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC203488L2 | Lenti ORF clone of Human regulator of G-protein signaling 10 (RGS10), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC203488L3 | Lenti ORF clone of Human regulator of G-protein signaling 10 (RGS10), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203488L4 | Lenti ORF clone of Human regulator of G-protein signaling 10 (RGS10), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG203488 | RGS10 (tGFP-tagged) - Human regulator of G-protein signaling 10 (RGS10), transcript variant 1 |
CNY 5,200.00 |
|
SC300912 | RGS10 (untagged)-Human regulator of G-protein signaling 10 (RGS10), transcript variant 1 |
CNY 3,990.00 |