HLA DMB (HLA-DMB) (NM_002118) Human Tagged ORF Clone

CAT#: RC203811

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DM beta (HLA-DMB)

ORF Plasmid: DDK tGFP



  "NM_002118" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


HLA-DMB rabbit polyclonal antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms D6S221E; RING7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203811 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCACATTCCTGCCGCTGCTGCTGGGGCTCAGCCTGGGCTGCACAGGAGCAGGTGGCTTCGTGGCCC
ATGTGGAAAGCACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTCCTTCAA
CAAGGATCTGCTGACCTGCTGGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAAT
AGCTTGGCGAATGTCCTCTCACAGCACCTCAACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGC
TTCAGAATTGTGCCACACACACCCAGCCCTTCTGGGGATCACTGACCAACAGGACACGGCCACCATCTGT
GCAAGTAGCCAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTC
TATCCAGCAGAAGTGACTATCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGCAGTGCGCACA
AGACTGCCCAGCCCAATGGAGACTGGACATACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGG
GGACACTTACACCTGTGTGGTAGAGCACATTGGGGCTCCTGAGCCCATCCTTCGGGACTGGACACCTGGG
CTGTCCCCCATGCAGACCCTGAAGGTTTCTGTGTCTGCAGTGACTCTGGGCCTGGGCCTCATCATCTTCT
CTCTTGGTGTGATCAGCTGGCGGAGAGCTGGCCACTCTAGTTACACTCCTCTTCCTGGGTCCAATTATTC
AGAAGGATGGCACATTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203811 protein sequence
Red=Cloning site Green=Tags(s)

MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLN
SLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGF
YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPG
LSPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHSSYTPLPGSNYSEGWHIS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002118
ORF Size 789 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_002118.3, NP_002109.1
RefSeq Size 1412 bp
RefSeq ORF 792 bp
Locus ID 3109
UniProt ID P28068
Domains MHC_II_beta, ig, IGc1
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
MW 28.9 kDa
Gene Summary HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...