TAX1BP3 (NM_014604) Human Tagged ORF Clone
CAT#: RC204776
TAX1BP3 (Myc-DDK-tagged)-Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1
ORF Plasmid: tGFP
"NM_014604" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | TIP-1; TIP1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC204776 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCTACATCCCGGGCCAGCCGGTCACCGCCGTGGTGCAAAGAGTTGAAATTCACAAGCTGCGTCAAG GTGAGAACTTAATCCTGGGTTTCAGCATTGGAGGTGGAATCGACCAGGACCCTTCCCAGAATCCCTTCTC TGAAGACAAGACGGACAAGGGTATTTATGTCACACGGGTGTCTGAAGGAGGCCCTGCTGAAATCGCTGGG CTGCAGATTGGAGACAAGATCATGCAGGTGAACGGCTGGGACATGACCATGGTCACACACGACCAGGCCC GCAAGCGGCTCACCAAGCGCTCGGAGGAGGTGGTGCGTCTGCTGGTGACGCGGCAGTCGCTGCAGAAGGC CGTGCAGCAGTCCATGCTGTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC204776 protein sequence
Red=Cloning site Green=Tags(s) MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAG LQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_014604 |
ORF Size | 372 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014604.1 |
RefSeq Size | 1398 bp |
RefSeq ORF | 375 bp |
Locus ID | 30851 |
UniProt ID | O14907 |
Domains | PDZ |
MW | 13.7 kDa |
Gene Summary | This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Apr 2017] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC204776L1 | Lenti ORF clone of Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC204776L2 | Lenti ORF clone of Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC204776L3 | Lenti ORF clone of Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC204776L4 | Lenti ORF clone of Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG204776 | TAX1BP3 (tGFP-tagged) - Human Tax1 (human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1 |
CNY 2,800.00 |
|
SC319925 | TAX1BP3 (untagged)-Human Tax1 (Human T-cell leukemia virus type I) binding protein 3 (TAX1BP3), transcript variant 1 |
CNY 1,200.00 |
其它TAX1BP3产品