PHPT1 (NM_014172) Human Tagged ORF Clone
CAT#: RC205124
PHPT1 (Myc-DDK-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3
ORF Plasmid: tGFP
"NM_014172" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CGI-202; HEL-S-132P; HSPC141; PHP; PHP14 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC205124 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGTGGCGGACCTCGCTCTCATTCCTGATGTGGACATCGACTCCGACGGCGTCTTCAAGTATGTGC TGATCCGAGTCCACTCGGCTCCCCGCTCCGGGGCTCCGGCTGCAGAGAGCAAGGAGATCGTGCGCGGCTA CAAGTGGGCTGAGTACCATGCGGACATCTACGACAAAGTGTCGGGCGACATGCAGAAGCAAGGCTGCGAC TGTGAGTGTCTGGGCGGCGGGCGCATCTCCCACCAGAGTCAGGACAAGAAGATTCACGTGTACGGCTATT CCATGGCCTATGGTCCTGCCCAGCACGCCATTTCAACTGAGAAAATCAAAGCCAAGTACCCCGACTACGA GGTCACCTGGGCTAACGACGGCTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC205124 protein sequence
Red=Cloning site Green=Tags(s) MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014172 |
ORF Size | 375 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_014172.6 |
RefSeq Size | 1199 bp |
RefSeq ORF | 378 bp |
Locus ID | 29085 |
UniProt ID | Q9NRX4 |
Domains | Ocnus |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism |
MW | 13.8 kDa |
Gene Summary | This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Histidine dephosphorylation of the Gβ protein GPB ‐1 promotes axon regeneration in C. elegans
,null,
EMBO Reports
,PubMed ID 36278516
[PHPT1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC205124L1 | Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC205124L2 | Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, mGFP tagged |
CNY 5,890.00 |
|
RC205124L3 | Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC205124L4 | Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, mGFP tagged |
CNY 5,890.00 |
|
RG205124 | PHPT1 (tGFP-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3 |
CNY 2,800.00 |
|
SC108149 | PHPT1 (untagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3 |
CNY 1,200.00 |