ZCRB1 (NM_033114) Human Tagged ORF Clone

CAT#: RC205492

ZCRB1 (Myc-DDK-tagged)-Human zinc finger CCHC-type and RNA binding motif 1 (ZCRB1)

ORF Plasmid: DDK tGFP



  "NM_033114" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal ZCRB1 Antibody
    • 100 ug

CNY 5,808.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms MADP-1; MADP1; RBM36; SNRNP31; ZCCHC19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205492 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGGTGGATTGGCTCCAAGTAAGAGCACAGTGTATGTATCCAACTTGCCTTTTTCCCTGACAAACA
ATGACTTGTACCGGATATTTTCCAAGTATGGCAAAGTTGTAAAGGTTACCATCATGAAAGATAAAGATAC
CAGGAAGAGTAAAGGGGTTGCATTTATTTTATTTTTGGATAAAGACTCTGCACAAAACTGTACCAGGGCA
ATAAACAACAAACAGTTATTTGGTAGAGTGATAAAAGCAAGCATTGCTATTGACAATGGAAGAGCAGCTG
AGTTCATCCGAAGGCGAAACTACTTTGATAAATCTAAGTGTTATGAATGTGGGGAAAGTGGACACTTAAG
TTATGCCTGTCCGAAAAATATGCTCGGAGAACGTGAGCCTCAAAAGAAGAAAGAAAAAAAGAAAAAAAAG
AAAGCTCCTGAACCAGAAGAAGAAATTGAGGAAGTAGAAGAAAGTGAAGATGAAGGGGAGGATCCTGCTC
TTGACAGCCTCAGTCAGGCCATAGCATTCCAGCAAGCCAAAATTGAAGAAGAACAAAAAAAATGGAAACC
CAGTTCAGGAGTCCCCTCAACATCAGATGATTCAAGACGCCCAAGGATAAAGAAAAGCACATATTTCAGT
GATGAGGAAGAACTTAGTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205492 protein sequence
Red=Cloning site Green=Tags(s)

MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRA
INNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGEREPQKKKEKKKKK
KAPEPEEEIEEVEESEDEGEDPALDSLSQAIAFQQAKIEEEQKKWKPSSGVPSTSDDSRRPRIKKSTYFS
DEEELSD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033114
ORF Size 651 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_033114.2
RefSeq Size 1844 bp
RefSeq ORF 654 bp
Locus ID 85437
UniProt ID Q8TBF4
Domains RRM, zf-CCHC, PAP_assoc, NTP_transf_2, RRM_1
MW 24.6 kDa
Gene Summary Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognizes the 5' splice site and branch-point sequence. U11 and U12 snRNPs are components of U12-type spliceosome and function as a molecular bridge connecting both ends of the intron. The protein encoded by this gene contains a RNA recognition motif. It was identified as one of the protein components of U11/U12 snRNPs. This protein and many other U11/U12 snRNP proteins are highly conserved in organisms known to contain U12-type introns. These proteins have been shown to be essential for cell viability, suggesting the key roles in U12-type splicing. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...