TPRKB (NM_016058) Human Tagged ORF Clone

CAT#: RC206008

TPRKB (Myc-DDK-tagged)-Human TP53RK binding protein (TPRKB)

ORF Plasmid: DDK tGFP



  "NM_016058" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


TPRKB mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
    • 100 ul

CNY 1,999.00
CNY 2,700.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CGI-121; CGI121; GAMOS5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206008 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGTTAACACATCAGCTGGACCTATTTCCCGAATGCAGGGTAACCCTTCTGTTATTTAAAGATGTAA
AAAATGCGGGAGACTTGAGAAGAAAGGCCATGGAAGGCACCATCGATGGATCACTGATAAATCCTACAGT
GATTGTTGATCCATTTCAGATACTTGTGGCAGCAAACAAAGCAGTTCACCTCTACAAACTGGGAAAAATG
AAGACAAGAACTCTATCTACTGAAATTATTTTCAACCTTTCCCCAAATAACAATATTTCAGAGGCTTTGA
AAAAATTTGGTATCTCAGCAAATGACACTTCAATTCTAATTGTTTACATTGAAGAGGGAGAAAAACAAAT
AAATCAAGAATACCTAATATCTCAAGTAGAAGGTCATCAGGTTTCTCTGAAAAATCTTCCTGAAATAATG
AATATTACAGAAGTCAAAAAGATATATAAACTCTCTTCACAAGAAGAAAGTATTGGGACATTATTGGATG
CTATCATTTGTAGAATGTCAACAAAAGATGTTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206008 protein sequence
Red=Cloning site Green=Tags(s)

MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKM
KTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIM
NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016058
ORF Size 525 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_016058.5
RefSeq Size 752 bp
RefSeq ORF 528 bp
Locus ID 51002
UniProt ID Q9Y3C4
MW 19.7 kDa
Gene Summary Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:28805828). The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37 (PubMed:22912744, PubMed:28805828). TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification (PubMed:22912744, PubMed:28805828).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...