United States
Germany
Japan
United Kingdom
China
PHLDA3 (NM_012396) Human Tagged ORF Clone
CAT＃: RC206751
PHLDA3 (Myc-DDK-tagged)-Human pleckstrin homology-like domain, family A, member 3 (PHLDA3)
ORF Plasmid: tGFP
"NM_012396" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
| Cited in 2 publications. |
Product images
CNY 300.00
Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | TIH1 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC206751 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACGGCGGCGGCGACGGCTACCGTGCTCAAGGAGGGCGTGCTGGAGAAGCGCAGCGGCGGGCTGCTGC AGCTGTGGAAGCGGAAGCGCTGCGTCCTCACCGAACGCGGGCTGCAGCTCTTCGAGGCCAAGGGCACGGG CGGCCGGCCCAAGGAGCTCAGCTTCGCCCGCATCAAGGCCGTGGAGTGCGTGGAGAGCACCGGGCGCCAC ATCTACTTCACGCTGGTGACCGAAGGGGGCGGCGAGATCGACTTCCGCTGCCCCCTGGAAGATCCCGGCT GGAACGCCCAGATCACCCTAGGCCTGGTCAAGTTCAAGAACCAGCAGGCCATCCAGACAGTGCGGGCCCG GCAGAGCCTCGGGACCGGGACCCTCGTGTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC206751 protein sequence
Red=Cloning site Green=Tags(s) MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_012396 |
| ORF Size | 381 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_012396.5 |
| RefSeq Size | 1516 bp |
| RefSeq ORF | 384 bp |
| Locus ID | 23612 |
| UniProt ID | Q9Y5J5 |
| Domains | PH |
| MW | 13.9 kDa |
| Gene Summary | p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Citations (2)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
PHLDA3 promotes lung adenocarcinoma cell proliferation and invasion via activation of the Wnt signaling pathway
,Lei, L;Wang, Y;Li, ZH;Fei, LR;Huang, WJ;Zheng, YW;Liu, CC;Yang, MQ;Wang, Z;Zou, ZF;Xu, HT;,
Laboratory investigation; a journal of technical methods and pathology
,PubMed ID 34006890
[PHLDA3]
|
|
Usefulness of an immunohistochemical score in advanced pancreatic neuroendocrine tumors treated with CAPTEM or everolimus
,Viúdez, A;Crespo, G;Gómez Dorronsoro, ML;Arozarena, I;Marín-Méndez, JJ;Custodio, A;Benavent, M;Goñi, S;García-Paredes, B;Hernando, J;Durantez, M;Alonso, V;Riesco, MDC;López, C;Jiménez-Fonseca, P;San Vicente, BL;González-Borja, I;Sevilla, I;Hernández-Garcia, I;Carmona-Bayonas, A;Capdevila, J;Pérez-Sanz, J;García-Carbonero, R;Pérez-Ricarte, L;Llanos, M;Vera, R;De Jesús Acosta, A;,
Pancreatology : official journal of the International Association of Pancreatology (IAP) ... [et al.] 2020
,PubMed ID 33358592
[PHLDA3]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC206751L1 | Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC206751L2 | Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), mGFP tagged |
CNY 5,890.00 |
|
| RC206751L3 | Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), Myc-DDK-tagged |
CNY 5,890.00 |
|
| RC206751L4 | Lenti ORF clone of Human pleckstrin homology-like domain, family A, member 3 (PHLDA3), mGFP tagged |
CNY 5,890.00 |
|
| RG206751 | PHLDA3 (tGFP-tagged) - Human pleckstrin homology-like domain, family A, member 3 (PHLDA3) |
CNY 2,800.00 |
|
| SC115414 | PHLDA3 (untagged)-Human pleckstrin homology-like domain, family A, member 3 (PHLDA3) |
CNY 1,200.00 |
