P311 (NREP) (NM_004772) Human Tagged ORF Clone
CAT#: RC209945
NREP (Myc-DDK-tagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1
ORF Plasmid: tGFP
"NM_004772" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
Cited in 1 publication. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | C5orf13; D4S114; P311; PRO1873; PTZ17; SEZ17 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC209945 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTTTATTACCCAGAACTCTTTGTCTGGGTCAGTCAAGAACCATTTCCAAACAAGGACATGGAGGGAA GGCTTCCTAAGGGAAGACTTCCTGTCCCAAAGGAAGTGAACCGCAAGAAGAACGATGAGACAAACGCTGC CTCCCTGACTCCACTGGGCAGCAGTGAACTCCGCTCCCCAAGAATCAGTTACCTCCACTTTTTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC209945 protein sequence
Red=Cloning site Green=Tags(s) MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_004772 |
ORF Size | 204 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_004772.4 |
RefSeq Size | 2026 bp |
RefSeq ORF | 207 bp |
Locus ID | 9315 |
UniProt ID | Q16612 |
MW | 7.9 kDa |
Gene Summary | May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this cDNA Clones has been cited in the following citations: |
---|
Parental metabolic syndrome epigenetically reprograms offspring hepatic lipid metabolism in mice
,De Jesus, DF;Orime, K;Kaminska, D;Kimura, T;Basile, G;Wang, CH;Haertle, L;Riemens, R;Brown, NK;Hu, J;Männistö, V;Silva, AM;Dirice, E;Tseng, YH;Haaf, T;Pihlajamäki, J;Kulkarni, RN;,
J. Clin. Invest.
,PubMed ID 32250344
[P311]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC209945L1 | Lenti ORF clone of Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC209945L2 | Lenti ORF clone of Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC209945L3 | Lenti ORF clone of Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC209945L4 | Lenti ORF clone of Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG209945 | NREP (tGFP-tagged) - Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1 |
CNY 2,800.00 |
|
SC108526 | NREP (untagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 1 |
CNY 1,200.00 |