alpha Synuclein (SNCA) (NM_000345) Human Tagged ORF Clone
CAT#: RC210606
SNCA (Myc-DDK-tagged)-Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1
ORF Plasmid: tGFP
"NM_000345" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CN¥ 1,200.00
CN¥ 3,705.00
Cited in 5 publications. |
CN¥ 300.00
CN¥ 1,999.00
CN¥ 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | NACP; PARK1; PARK4; PD1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC210606 representing NM_000345
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAAC AGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGG AGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTG GTGACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCT TTGTCAAAAAGGACCAGTTGGGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCC TGTGGATCCTGACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC210606 representing NM_000345
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000345 |
ORF Size | 420 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_000345.4 |
RefSeq Size | 1543 bp |
RefSeq ORF | 423 bp |
Locus ID | 6622 |
UniProt ID | P37840 |
Domains | Synuclein |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
MW | 14.3 kDa |
Gene Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
Citations (5)
The use of this cDNA Clones has been cited in the following citations: |
---|
α‐Synuclein antisense transcript SNCA‐AS1 regulates synapses‐ and aging‐related genes suggesting its implication in Parkinson's disease
,null,
Aging Cell
,PubMed ID 34799977
[alpha Synuclein]
|
Overexpression of α-Synuclein Reorganises Growth Factor Profile of Human Astrocytes
,Şengül, B;Dursun, E;Verkhratsky, A;Gezen-Ak, D;,
Mol. Neurobiol.
,PubMed ID 32914394
[alpha Synuclein]
|
Inactive USP14 and inactive UCHL5 cause accumulation of distinct ubiquitinated proteins in mammalian cells
,Chadchankar, J;Korboukh, V;Conway, LC;Wobst, HJ;Walker, CA;Doig, P;Jacobsen, SJ;Brandon, NJ;Moss, SJ;Wang, Q;,
PLoS ONE
,PubMed ID 31703099
[alpha Synuclein]
|
A stress-enhanced model for discovery of disease-modifying gene: Ece1-suppresses the toxicity of α-synuclein A30P
,Chen, AY;Tully, T;,
Neurobiol. Dis.
,PubMed ID 29524599
[alpha Synuclein]
|
Unconventional secretion of misfolded proteins promotes adaptation to proteasome dysfunction in mammalian cells
,Lee, JG;Takahama, S;Zhang, G;Tomarev, SI;Ye, Y;,
Nat. Cell Biol.
,PubMed ID 27295555
[alpha Synuclein]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC210606L1 | Lenti ORF clone of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, Myc-DDK-tagged |
CN¥ 3,600.00 |
|
RC210606L2 | Lenti ORF clone of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, mGFP tagged |
CN¥ 3,600.00 |
|
RC210606L3 | Lenti ORF clone of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, Myc-DDK-tagged |
CN¥ 3,600.00 |
|
RC210606L4 | Lenti ORF clone of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, mGFP tagged |
CN¥ 3,600.00 |
|
RG210606 | SNCA (tGFP-tagged) - Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CN¥ 2,800.00 |
|
SC119919 | SNCA (untagged)-Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
CN¥ 1,200.00 |
其它alpha Synuclein产品