RBM24 (NM_153020) Human Tagged ORF Clone
CAT#: RC211161
RBM24 (Myc-DDK-tagged)-Human RNA binding motif protein 24 (RBM24), transcript variant 2
ORF Plasmid: tGFP
"NM_153020" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | dJ259A10.1; RNPC6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC211161 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTATGTATGTCTGTGTGTGTCTGTTGCTAAGGTCACCATGGCTGACCGGGCTGCTGCCGAAAGGGCCT GCAAGGATCCCAATCCCATCATTGATGGCAGAAAGGCCAACGTGAACCTGGCATACTTAGGAGCAAAACC AAGGATCATGCAACCAGGTTTTGCCTTTGGTGTTCAACAACTTCATCCAGCCCTTATACAAAGACCTTTC GGGATACCTGCCCACTATGTCTATCCGCAGGCTTTTGTGCAGCCGGGAGTGGTCATTCCACACGTCCAGC CGACAGCAGCTGCCGCCTCCACCACCCCTTACATTGATTACACTGGAGCTGCATACGCACAATACTCAGC AGCTGCTGCTGCTGCCGCCGCCGCTGCTGCCTATGACCAGTACCCCTATGCAGCCTCTCCAGCTGCTGCA GGATATGTTACTGCTGGGGGCTATGGCTACGCAGTCCAGCAGCCAATCACCGCAGCGGCACCTGGGACAG CTGCCGCCGCCGCTGCAGCAGCTGCTGCCGCTGCAGCATTTGGCCAGTACCAGCCTCAGCAGCTGCAGAC AGACCGAATGCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC211161 protein sequence
Red=Cloning site Green=Tags(s) MYVCLCVSVAKVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPF GIPAHYVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGAAYAQYSAAAAAAAAAAAYDQYPYAASPAAA GYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQYQPQQLQTDRMQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_153020 |
ORF Size | 573 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_153020.2, NP_694565.1 |
RefSeq Size | 2399 bp |
RefSeq ORF | 576 bp |
Locus ID | 221662 |
UniProt ID | Q9BX46 |
Protein Families | Druggable Genome |
MW | 19.6 kDa |
Gene Summary | Multifunctional RNA-binding protein involved in the regulation of pre-mRNA splicing, mRNA stability and mRNA translation important for cell fate decision and differentiation (PubMed:20977548, PubMed:24375645, PubMed:29358667, PubMed:29104163). Plays a major role in pre-mRNA alternative splicing regulation (PubMed:26990106, PubMed:29104163). Mediates preferentially muscle-specific exon inclusion in numerous mRNAs important for striated cardiac and skeletal muscle cell differentiation (PubMed:29104163). Binds to intronic splicing enhancer (ISE) composed of stretches of GU-rich motifs localized in flanking intron of exon that will be included by alternative splicing (By similarity). Involved in embryonic stem cell (ESC) transition to cardiac cell differentiation by promoting pre-mRNA alternative splicing events of several pluripotency and/or differentiation genes (PubMed:26990106). Plays a role in the regulation of mRNA stability (PubMed:20977548, PubMed:24356969, PubMed:24375645, PubMed:29104163). Binds to 3'-untranslated region (UTR) AU-rich elements in target transcripts, such as CDKN1A and MYOG, leading to maintain their stabilities (PubMed:20977548, PubMed:24356969). Involved in myogenic differentiation by regulating MYOG levels (PubMed:20977548). Binds to multiple regions in the mRNA 3' UTR of TP63 isoform 2, hence inducing its destabilization (PubMed:24375645). Promotes also the destabilization of the CHRM2 mRNA via its binding to a region in the coding sequence (PubMed:29104163). Plays a role in the regulation of mRNA translation (PubMed:29358667). Mediates repression of p53/TP53 mRNA translation through its binding to U-rich element in the 3' UTR, hence preventing EIF4E from binding to p53/TP53 mRNA and translation initiation (PubMed:29358667). Binds to a huge amount of mRNAs (PubMed:29104163). Required for embryonic heart development, sarcomer and M-band formation in striated muscles (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC211161L3 | Lenti ORF clone of Human RNA binding motif protein 24 (RBM24), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC211161L4 | Lenti ORF clone of Human RNA binding motif protein 24 (RBM24), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG211161 | RBM24 (tGFP-tagged) - Human RNA binding motif protein 24 (RBM24), transcript variant 2 |
CNY 4,000.00 |
|
SC306539 | RBM24 (untagged)-Human RNA binding motif protein 24 (RBM24), transcript variant 2 |
CNY 3,990.00 |