Neutrophil defensin 4 (DEFA4) (NM_001925) Human Tagged ORF Clone
CAT#: RC213236
DEFA4 (Myc-DDK-tagged)-Human defensin, alpha 4, corticostatin (DEFA4)
ORF Plasmid: tGFP
"NM_001925" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,705.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | DEF4; HNP-4; HP-4; HP4 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213236 representing NM_001925
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGATTATCGCCCTCCTCGCTGCTATTCTCTTGGTAGCCCTCCAGGTCCGGGCAGGCCCACTCCAGG CAAGAGGTGATGAGGCTCCAGGCCAGGAGCAGCGTGGGCCAGAAGACCAGGACATATCTATTTCCTTTGC ATGGGATAAAAGCTCTGCTCTTCAGGTTTCAGGCTCAACAAGGGGCATGGTCTGCTCTTGCAGATTAGTA TTCTGCCGGCGAACAGAACTTCGTGTTGGGAACTGCCTCATTGGTGGTGTGAGTTTCACATACTGCTGCA CGCGTGTCGAT AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGATAAGGTTTAA >RC213236 representing NM_001925
Red=Cloning site Green=Tags(s) MRIIALLAAILLVALQVRAGPLQARGDEAPGQEQRGPEDQDISISFAWDKSSALQVSGSTRGMVCSCRLV FCRRTELRVGNCLIGGVSFTYCCTRVD SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-RsrII Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001925 |
ORF Size | 291 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_001925.3 |
RefSeq Size | 542 bp |
RefSeq ORF | 294 bp |
Locus ID | 1669 |
UniProt ID | P12838 |
Domains | Defensin_propep, DEFSN, defensins |
Protein Families | Secreted Protein |
MW | 10.5 kDa |
Gene Summary | Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. Several alpha defensin genes are clustered on chromosome 8. This gene differs from other genes of this family by an extra 83-base segment that is apparently the result of a recent duplication within the coding region. The protein encoded by this gene, defensin, alpha 4, is found in the neutrophils; it exhibits corticostatic activity and inhibits corticotropin stimulated corticosterone production. [provided by RefSeq, Oct 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213236L3 | Lenti-ORF clone of DEFA4 (Myc-DDK-tagged)-Human defensin, alpha 4, corticostatin (DEFA4) |
CNY 5,890.00 |
|
RC213236L4 | Lenti-ORF clone of DEFA4 (mGFP-tagged)-Human defensin, alpha 4, corticostatin (DEFA4) |
CNY 5,890.00 |
|
RG213236 | DEFA4 (tGFP-tagged) - Human defensin, alpha 4, corticostatin (DEFA4) |
CNY 4,370.00 |
|
SC118948 | DEFA4 (untagged)-Human defensin, alpha 4, corticostatin (DEFA4) |
CNY 1,200.00 |
其它Neutrophil defensin 4产品