United States
Germany
Japan
United Kingdom
China
TMS1 (PYCARD) (NM_013258) Human Tagged ORF Clone
CAT＃: RC215592
PYCARD (Myc-DDK-tagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1
ORF Plasmid: tGFP
"NM_013258" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
| Cited in 3 publications. |
Product images
CNY 300.00
CNY 1,999.00
CNY 2,700.00
热销推荐Specifications
| Product Data | |
| Type | Human Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | ASC; CARD5; TMS; TMS-1; TMS1 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>RC215592 representing NM_013258
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGCGCGCGCGCGACGCCATCCTGGATGCGCTGGAGAACCTGACCGCCGAGGAGCTCAAGAAGTTCA AGCTGAAGCTGCTGTCGGTGCCGCTGCGCGAGGGCTACGGGCGCATCCCGCGGGGCGCGCTGCTGTCCAT GGACGCCTTGGACCTCACCGACAAGCTGGTCAGCTTTTACCTGGAGACCTACGGCGCCGAGCTCACCGCT AACGTGCTGCGCGACATGGGCCTGCAGGAGATGGCCGGGCAGCTGCAGGCGGCCACGCACCAGGGCTCTG GAGCCGCGCCAGCTGGGATCCAGGCCCCTCCTCAGTCGGCAGCCAAGCCAGGCCTGCACTTTATAGACCA GCACCGGGCTGCGCTTATCGCGAGGGTCACAAACGTTGAGTGGCTGCTGGATGCTCTGTACGGGAAGGTC CTGACGGATGAGCAGTACCAGGCAGTGCGGGCCGAGCCCACCAACCCAAGCAAGATGCGGAAGCTCTTCA GTTTCACACCAGCCTGGAACTGGACCTGCAAGGACTTGCTCCTCCAGGCCCTAAGGGAGTCCCAGTCCTA CCTGGTGGAGGACCTGGAGCGGAGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215592 representing NM_013258
Red=Cloning site Green=Tags(s) MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS myc-FLAG tag |
| Chromatograms |
CHROMATOGRAMS
 Sequencher program is needed, download here. |
| Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
|
| ACCN | NM_013258 |
| ORF Size | 585 bp |
| OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | NM_013258.5 |
| RefSeq Size | 936 bp |
| RefSeq ORF | 588 bp |
| Locus ID | 29108 |
| UniProt ID | Q9ULZ3 |
| Domains | PAAD_DAPIN |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
| MW | 21.4 kDa |
| Gene Summary | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Citations (3)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
Prdx4 limits caspase‐1 activation and restricts inflammasome‐mediated signaling by extracellular vesicles
,null,
The EMBO Journal
,PubMed ID 31544965
[TMS1]
|
|
DPP8/9 inhibitors are universal activators of functional NLRP1 alleles
,Gai, K;Okondo, MC;Rao, SD;Chui, AJ;Ball, DP;Johnson, DC;Bachovchin, DA;,
Cell Death Dis
,PubMed ID 31383852
[TMS1]
|
|
Biallelic hypomorphic mutations in a linear deubiquitinase define otulipenia, an early-onset autoinflammatory disease
,Zhou, Q;Yu, X;Demirkaya, E;Deuitch, N;Stone, D;Tsai, WL;Kuehn, HS;Wang, H;Yang, D;Park, YH;Ombrello, AK;Blake, M;Romeo, T;Remmers, EF;Chae, JJ;Mullikin, JC;Güzel, F;Milner, JD;Boehm, M;Rosenzweig, SD;Gadina, M;Welch, SB;Özen, S;Topaloglu, R;Abinun, M;Kastner, DL;Aksentijevich, I;,
Proc. Natl. Acad. Sci. U.S.A.
,PubMed ID 27559085
[TMS1]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| RC215592L1 | Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC215592L2 | Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
| RC215592L3 | Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, Myc-DDK-tagged |
CNY 4,800.00 |
|
| RC215592L4 | Lenti ORF clone of Human PYD and CARD domain containing (PYCARD), transcript variant 1, mGFP tagged |
CNY 4,800.00 |
|
| RG215592 | PYCARD (tGFP-tagged) - Human PYD and CARD domain containing (PYCARD), transcript variant 1 |
CNY 4,000.00 |
|
| SC115313 | PYCARD (untagged)-Human PYD and CARD domain containing (PYCARD), transcript variant 1 |
CNY 2,400.00 |
