SM22 alpha (TAGLN) (NM_003186) Human Tagged ORF Clone
CAT#: RC215789
TAGLN (Myc-DDK-tagged)-Human transgelin (TAGLN), transcript variant 2
ORF Plasmid: tGFP
"NM_003186" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,400.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | SM22; SM22-alpha; SMCC; TAGLN1; WS3-10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC215789 representing NM_003186
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCAACAAGGGTCCTTCCTATGGCATGAGCCGCGAAGTGCAGTCCAAAATCGAGAAGAAGTATGACG AGGAGCTGGAGGAGCGGCTGGTGGAGTGGATCATAGTGCAGTGTGGCCCTGATGTGGGCCGCCCAGACCG TGGGCGCTTGGGCTTCCAGGTCTGGCTGAAGAATGGCGTGATTCTGAGCAAGCTGGTGAACAGCCTGTAC CCTGATGGCTCCAAGCCGGTGAAGGTGCCCGAGAACCCACCCTCCATGGTCTTCAAGCAGATGGAGCAGG TGGCTCAGTTCCTGAAGGCGGCTGAGGACTATGGGGTCATCAAGACTGACATGTTCCAGACTGTTGACCT CTTTGAAGGCAAAGACATGGCAGCAGTGCAGAGGACCCTGATGGCTTTGGGCAGCTTGGCAGTGACCAAG AATGATGGGCACTACCGTGGAGATCCCAACTGGTTTATGAAGAAAGCGCAGGAGCATAAGAGGGAATTCA CAGAGAGCCAGCTGCAGGAGGGAAAGCATGTCATTGGCCTTCAGATGGGCAGCAACAGAGGGGCCTCCCA GGCCGGCATGACAGGCTACGGACGACCTCGGCAGATCATCAGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215789 representing NM_003186
Red=Cloning site Green=Tags(s) MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_003186 |
ORF Size | 603 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_003186.5 |
RefSeq Size | 1177 bp |
RefSeq ORF | 606 bp |
Locus ID | 6876 |
UniProt ID | Q01995 |
Domains | calponin, CH |
MW | 22.4 kDa |
Gene Summary | This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. [provided by RefSeq, Aug 2017] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
GRASP55 regulates the unconventional secretion and aggregation of mutant huntingtin
,null,
The Journal of Biological Chemistry
,PubMed ID 35780830
[SM22 alpha]
|
Proteomic signatures corresponding to the SS18/SSX fusion gene in synovial sarcoma
,Ishii, M;Suehara, Y;Sano, K;Kohsaka, S;Hayashi, T;Kazuno, S;Akaike, K;Mukaihara, K;Kim, Y;Okubo, T;Takamochi, K;Takahashi, F;Kaneko, K;Saito, T;,
Oncotarget
,PubMed ID 30680066
[SM22 alpha]
|
Transgelin gene is frequently downregulated by promoter DNA hypermethylation in breast cancer
,null,
Clinical Epigenetics
,PubMed ID 26421063
[SM22 alpha]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC215789L1 | Lenti ORF clone of Human transgelin (TAGLN), transcript variant 2, Myc-DDK-tagged |
CNY 4,800.00 |
|
RC215789L2 | Lenti ORF clone of Human transgelin (TAGLN), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC215789L3 | Lenti ORF clone of Human transgelin (TAGLN), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC215789L4 | Lenti ORF clone of Human transgelin (TAGLN), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG215789 | TAGLN (tGFP-tagged) - Human transgelin (TAGLN), transcript variant 2 |
CNY 4,000.00 |
|
SC118118 | TAGLN (untagged)-Human transgelin (TAGLN), transcript variant 2 |
CNY 2,400.00 |
其它SM22 alpha产品