STAT3 (NM_139276) Human Tagged ORF Clone
CAT#: RC215836
STAT3 (Myc-DDK-tagged)-Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1
ORF Plasmid: tGFP
"NM_139276" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 8,456.00
Cited in 23 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ADMIO; ADMIO1; APRF; HIES |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC215836 representing NM_139276
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCCAATGGAATCAGCTACAGCAGCTTGACACACGGTACCTGGAGCAGCTCCATCAGCTCTACAGTG ACAGCTTCCCAATGGAGCTGCGGCAGTTTCTGGCCCCTTGGATTGAGAGTCAAGATTGGGCATATGCGGC CAGCAAAGAATCACATGCCACTTTGGTGTTTCATAATCTCCTGGGAGAGATTGACCAGCAGTATAGCCGC TTCCTGCAAGAGTCGAATGTTCTCTATCAGCACAATCTACGAAGAATCAAGCAGTTTCTTCAGAGCAGGT ATCTTGAGAAGCCAATGGAGATTGCCCGGATTGTGGCCCGGTGCCTGTGGGAAGAATCACGCCTTCTACA GACTGCAGCCACTGCGGCCCAGCAAGGGGGCCAGGCCAACCACCCCACAGCAGCCGTGGTGACGGAGAAG CAGCAGATGCTGGAGCAGCACCTTCAGGATGTCCGGAAGAGAGTGCAGGATCTAGAACAGAAAATGAAAG TGGTAGAGAATCTCCAGGATGACTTTGATTTCAACTATAAAACCCTCAAGAGTCAAGGAGACATGCAAGA TCTGAATGGAAACAACCAGTCAGTGACCAGGCAGAAGATGCAGCAGCTGGAACAGATGCTCACTGCGCTG GACCAGATGCGGAGAAGCATCGTGAGTGAGCTGGCGGGGCTTTTGTCAGCGATGGAGTACGTGCAGAAAA CTCTCACGGACGAGGAGCTGGCTGACTGGAAGAGGCGGCAACAGATTGCCTGCATTGGAGGCCCGCCCAA CATCTGCCTAGATCGGCTAGAAAACTGGATAACGTCATTAGCAGAATCTCAACTTCAGACCCGTCAACAA ATTAAGAAACTGGAGGAGTTGCAGCAAAAAGTTTCCTACAAAGGGGACCCCATTGTACAGCACCGGCCGA TGCTGGAGGAGAGAATCGTGGAGCTGTTTAGAAACTTAATGAAAAGTGCCTTTGTGGTGGAGCGGCAGCC CTGCATGCCCATGCATCCTGACCGGCCCCTCGTCATCAAGACCGGCGTCCAGTTCACTACTAAAGTCAGG TTGCTGGTCAAATTCCCTGAGTTGAATTATCAGCTTAAAATTAAAGTGTGCATTGACAAAGACTCTGGGG ACGTTGCAGCTCTCAGAGGATCCCGGAAATTTAACATTCTGGGCACAAACACAAAAGTGATGAACATGGA AGAATCCAACAACGGCAGCCTCTCTGCAGAATTCAAACACTTGACCCTGAGGGAGCAGAGATGTGGGAAT GGGGGCCGAGCCAATTGTGATGCTTCCCTGATTGTGACTGAGGAGCTGCACCTGATCACCTTTGAGACCG AGGTGTATCACCAAGGCCTCAAGATTGACCTAGAGACCCACTCCTTGCCAGTTGTGGTGATCTCCAACAT CTGTCAGATGCCAAATGCCTGGGCGTCCATCCTGTGGTACAACATGCTGACCAACAATCCCAAGAATGTA AACTTTTTTACCAAGCCCCCAATTGGAACCTGGGATCAAGTGGCCGAGGTCCTGAGCTGGCAGTTCTCCT CCACCACCAAGCGAGGACTGAGCATCGAGCAGCTGACTACACTGGCAGAGAAACTCTTGGGACCTGGTGT GAATTATTCAGGGTGTCAGATCACATGGGCTAAATTTTGCAAAGAAAACATGGCTGGCAAGGGCTTCTCC TTCTGGGTCTGGCTGGACAATATCATTGACCTTGTGAAAAAGTACATCCTGGCCCTTTGGAACGAAGGGT ACATCATGGGCTTTATCAGTAAGGAGCGGGAGCGGGCCATCTTGAGCACTAAGCCTCCAGGCACCTTCCT GCTAAGATTCAGTGAAAGCAGCAAAGAAGGAGGCGTCACTTTCACTTGGGTGGAGAAGGACATCAGCGGT AAGACCCAGATCCAGTCCGTGGAACCATACACAAAGCAGCAGCTGAACAACATGTCATTTGCTGAAATCA TCATGGGCTATAAGATCATGGATGCTACCAATATCCTGGTGTCTCCACTGGTCTATCTCTATCCTGACAT TCCCAAGGAGGAGGCATTCGGAAAGTATTGTCGGCCAGAGAGCCAGGAGCATCCTGAAGCTGACCCAGGT AGCGCTGCCCCATACCTGAAGACCAAGTTTATCTGTGTGACACCAACGACCTGCAGCAATACCATTGACC TGCCGATGTCCCCCCGCACTTTAGATTCATTGATGCAGTTTGGAAATAATGGTGAAGGTGCTGAACCCTC AGCAGGAGGGCAGTTTGAGTCCCTCACCTTTGACATGGAGTTGACCTCGGAGTGCGCTACCTCCCCCATG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC215836 representing NM_139276
Red=Cloning site Green=Tags(s) MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR FLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL DQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ IKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV NFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFS FWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_139276 |
ORF Size | 2310 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | NM_139276.3 |
RefSeq Size | 4978 bp |
RefSeq ORF | 2313 bp |
Locus ID | 6774 |
UniProt ID | P40763 |
Domains | SH2, STAT |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Chemokine signaling pathway, Jak-STAT signaling pathway, Pancreatic cancer, Pathways in cancer |
MW | 87.9 kDa |
Gene Summary | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome. [provided by RefSeq, Aug 2020] |
Citations (23)
The use of this cDNA Clones has been cited in the following citations: |
---|
Design, Synthesis, and Biological Activity of Marinacarboline Analogues as STAT3 Pathway Inhibitors for Docetaxel-Resistant Triple-Negative Breast Cancer.
,null,
Journal of medicinal chemistry
,PubMed ID 36786551
[STAT3]
|
Nintedanib induces senolytic effect via STAT3 inhibition
,null,
Cell Death & Disease
,PubMed ID 36055997
[STAT3]
|
SHP-1/STAT3-Signaling-Axis-Regulated Coupling between BECN1 and SLC7A11 Contributes to Sorafenib-Induced Ferroptosis in Hepatocellular Carcinoma
,null,
International Journal of Molecular Sciences
,PubMed ID 36232407
[STAT3]
|
EGFR ligand shifts the role of EGFR from oncogene to tumour suppressor in EGFR-amplified glioblastoma by suppressing invasion through BIN3 upregulation.
,null,
Nature cell biology
,PubMed ID 35915159
[STAT3]
|
Periplogenin suppresses the growth of esophageal squamous cell carcinoma in vitro and in vivo by targeting STAT3.
,null,
Oncogene
,PubMed ID 33986510
[STAT3]
|
Human STAT3 variants underlie autosomal dominant hyper-IgE syndrome by negative dominance
,Asano, T;Khourieh, J;Zhang, P;Rapaport, F;Spaan, AN;Li, J;Lei, WT;Pelham, SJ;Hum, D;Chrabieh, M;Han, JE;Guérin, A;Mackie, J;Gupta, S;Saikia, B;Baghdadi, JEI;Fadil, I;Bousfiha, A;Habib, T;Marr, N;Ganeshanandan, L;Peake, J;Droney, L;Williams, A;Celmeli, F;Hatipoglu, N;Ozcelik, T;Picard, C;Abel, L;Tangye, SG;Boisson-Dupuis, S;Zhang, Q;Puel, A;Béziat, V;Casanova, JL;Boisson, B;,
The Journal of experimental medicine
,PubMed ID 34137790
[STAT3]
|
Antitumor Activity of Pulvomycin via Targeting Activated-STAT3 Signaling in Docetaxel-Resistant Triple-Negative Breast Cancer Cells
,Byun, WS;Bae, ES;Cui, J;Park, HJ;Oh, DC;Lee, SK;,
Biomedicines
,PubMed ID 33920736
[STAT3]
|
A Potent and Selective Small-Molecule Degrader of STAT3 Achieves Complete Tumor Regression In Vivo
,Bai, L;Zhou, H;Xu, R;Zhao, Y;Chinnaswamy, K;McEachern, D;Chen, J;Yang, CY;Liu, Z;Wang, M;Liu, L;Jiang, H;Wen, B;Kumar, P;Meagher, JL;Sun, D;Stuckey, JA;Wang, S;,
Cancer Cell
,PubMed ID 31715132
[STAT3]
|
Long noncoding RNA NEAT1 drives aggressive endometrial cancer progression via miR-361-regulated networks involving STAT3 and tumor microenvironment-related genes
,Dong, P;Xiong, Y;Yue, J;Xu, D;Ihira, K;Konno, Y;Kobayashi, N;Todo, Y;Watari, H;,
J. Exp. Clin. Cancer Res.
,PubMed ID 31287002
[STAT3]
|
A Novel STAT3 Mutation in a Qatari Patient With Hyper-IgE Syndrome
,Chaimowitz, NS;Branch, J;Reyes, A;Vargas-Hernández, A;Orange, JS;Forbes, LR;Ehlayel, M;Purayil, SC;Al-Nesf, MA;Vogel, TP;,
Front Pediatr
,PubMed ID 31069200
[STAT3]
|
Phospho-valproic acid (MDC-1112) suppresses glioblastoma growth in preclinical models through the inhibition of STAT3 phosphorylation
,Luo, D;Fraga-Lauhirat, M;Millings, J;Ho, C;Villarreal, EM;Fletchinger, TC;Bonfiglio, JV;Mata, L;Nemesure, MD;Bartels, LE;Wang, R;Rigas, B;Mackenzie, GG;,
Carcinogenesis
,PubMed ID 30994173
[STAT3]
|
Efficacy of Ruxolitinib Therapy in a Patient with Severe Enterocolitis Associated with a STAT3 Gain of Function Mutation
,Parlato, M;Charbit-Henrion, F;Nader, EA;Begue, B;Guegan, N;Bruneau, J;Khater, S;Macintyre, E;Picard, C;Rieux-Laucat, F;Le Bourhis, L;Allez, M;Goulet, O;Cellier, C;Hermine, O;Cerf-Bensussan, N;Malamut, G;,
Gastroenterology
,PubMed ID 30557559
[STAT3]
|
FBXL14 abolishes breast cancer progression by targeting CDCP1 for proteasomal degradation
,Cui, YH;Kim, H;Lee, M;Yi, JM;Kim, RK;Uddin, N;Yoo, KC;Kang, JH;Choi, MY;Cha, HJ;Kwon, OS;Bae, IH;Kim, MJ;Kaushik, N;Lee, SJ;,
Oncogene
,PubMed ID 29973690
[STAT3]
|
Decoction of Chinese Herbal Medicine Fuzheng Kang-Ai Induces Lung Cancer Cell Apoptosis via STAT3/Bcl-2/Caspase-3 Pathway
,Wang, S;Long, S;Xiao, S;Wu, W;Hann, SS;,
Evid Based Complement Alternat Med
,PubMed ID 30046347
[STAT3]
|
Aberrant expression of NKL homeobox gene HLX in Hodgkin lymphoma
,Nagel, S;Pommerenke, C;Meyer, C;Kaufmann, M;MacLeod, RAF;Drexler, HG;,
Oncotarget
,PubMed ID 29581848
[STAT3]
|
Partial growth hormone insensitivity and dysregulatory immune disease associated with de novo germline activating STAT3 mutations
,Gutiérrez, M;Scaglia, P;Keselman, A;Martucci, L;Karabatas, L;Domené, S;Martin, A;Pennisi, P;Blanco, M;Sanguineti, N;Bezrodnik, L;Di Giovanni, D;Caldirola, MS;Azcoiti, ME;Gaillard, MI;Denson, LA;Zhang, K;Husami, A;Yayah Jones, NH;Hwa, V;Revale, S;Vázquez, M;Jasper, H;Kumar, A;Domené, H;,
Mol. Cell. Endocrinol.
,PubMed ID 29378236
[STAT3]
|
Activation of ERK and Mutual Regulation of Stat3 and SP1 Contribute to Inhibition of PDK1 Expression by Atractylenolide-1 in Human Lung Cancer Cells
,Xiao, Q;Zheng, F;Wu, J;Tang, Q;Wang, W;Hann, SS;,
Cell. Physiol. Biochem.
,PubMed ID 29073620
[STAT3]
|
STAT3 inhibitor enhances chemotherapy drug efficacy by modulating mucin 1 expression in non-small cell lung carcinoma
,Han, Y;Lu, X;Wang, G;,
Tropical Journal of Pharmaceutical Research
[STAT3]
|
Interplay of DNA methyltransferase 1 and EZH2 through inactivation of Stat3 contributes to β-elemene-inhibited growth of nasopharyngeal carcinoma cells
,Wu, J;Tang, Q;Yang, L;Chen, Y;Zheng, F;Hann, SS;,
Sci Rep
,PubMed ID 28360411
[STAT3]
|
Endogenous transmembrane protein UT2 inhibits pSTAT3 and suppresses hematological malignancy
,Lee, D;Wang, YH;Kalaitzidis, D;Ramachandran, J;Eda, H;Sykes, DB;Raje, N;Scadden, DT;,
J. Clin. Invest.
,PubMed ID 26927669
[STAT3]
|
Early-onset lymphoproliferation and autoimmunity caused by germline STAT3 gain-of-function mutations
,null,
Blood
,PubMed ID 25359994
[STAT3]
|
RFX1–dependent activation of SHP-1 induces autophagy by a novel obatoclax derivative in hepatocellular carcinoma cells
,null,
Oncotarget
,PubMed ID 24952874
[STAT3]
|
Mitogenic and Oncogenic Stimulation of K433 Acetylation Promotes PKM2 Protein Kinase Activity and Nuclear Localization
,Lv, L;Xu, YP;Zhao, D;Li, FL;Wang, W;Sasaki, N;Jiang, Y;Zhou, X;Li, TT;Guan, KL;Lei, QY;Xiong, Y;,
Mol Cell. 2013 Nov 7;52(3):340-52.
,PubMed ID 24120661
[STAT3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC215836L1 | Lenti ORF clone of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, Myc-DDK-tagged |
CNY 10,856.00 |
|
RC215836L2 | Lenti ORF clone of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mGFP tagged |
CNY 10,856.00 |
|
RC215836L3 | Lenti ORF clone of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, Myc-DDK-tagged |
CNY 10,856.00 |
|
RC215836L4 | Lenti ORF clone of Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1, mGFP tagged |
CNY 10,856.00 |
|
RG215836 | STAT3 (tGFP-tagged) - Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1 |
CNY 10,056.00 |
|
SC124165 | STAT3 (untagged)-Human signal transducer and activator of transcription 3 (acute-phase response factor) (STAT3), transcript variant 1 |
CNY 8,472.00 |