DYNLT1 (NM_006519) Human Tagged ORF Clone
CAT#: RC218331
DYNLT1 (Myc-DDK-tagged)-Human dynein, light chain, Tctex-type 1 (DYNLT1)
ORF Plasmid: tGFP
"NM_006519" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 4,180.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CW-1; TCTEL1; tctex-1; TCTEX1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC218331 representing NM_006519
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAAGACTACCAGGCTGCGGAGGAGACTGCTTTTGTTGTTGATGAAGTGAGCAACATTGTAAAAGAGG CTATAGAAAGCGCAATTGGTGGTAACGCTTATCAACACAGCAAAGTGAACCAGTGGACCACAAATGTAGT AGAACAAACTTTAAGCCAACTCACCAAGCTGGGAAAACCATTTAAATACATCGTGACCTGTGTAATTATG CAGAAGAATGGAGCTGGATTACACACAGCAAGTTCCTGCTTCTGGGACAGCTCTACTGACGGGAGCTGCA CTGTGCGATGGGAGAATAAGACCATGTACTGCATCGTCAGTGCCTTCGGACTGTCTATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC218331 representing NM_006519
Red=Cloning site Green=Tags(s) MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_006519 |
ORF Size | 339 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006519.4 |
RefSeq Size | 713 bp |
RefSeq ORF | 342 bp |
Locus ID | 6993 |
UniProt ID | P63172 |
Domains | Tctex-1 |
MW | 12.3 kDa |
Gene Summary | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC218331L1 | Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC218331L2 | Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), mGFP tagged |
CNY 5,890.00 |
|
RC218331L3 | Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC218331L4 | Lenti ORF clone of Human dynein, light chain, Tctex-type 1 (DYNLT1), mGFP tagged |
CNY 4,200.00 |
|
RG218331 | DYNLT1 (tGFP-tagged) - Human dynein, light chain, Tctex-type 1 (DYNLT1) |
CNY 4,370.00 |
|
SC126752 | DYNLT1 (untagged)-Human dynein, light chain, Tctex-type 1 (DYNLT1) |
CNY 1,800.00 |