LILRA5 (NM_181879) Human Tagged ORF Clone

CAT#: RC219364

  • TrueORF®

LILRA5 (Myc-DDK-tagged)-Human leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 (LILRA5), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_181879" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-LILRA5 Antibody
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms CD85; CD85F; ILT-11; ILT11; LILRB7; LIR-9; LIR9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219364 representing NM_181879
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCATGGTCTCATCCATCTGCACAGCTGCAGCCAGTGGGAGGAGACGCCGTGAGCCCTGCCCTCA
TGGTTCTGCTCTGCCTCGGGCTGAGTCTGGGCCCCAGGACCCACGTGCAGGCAGGGAACCTCTCCAAAGC
CACCCTCTGGGCTGAGCCAGGCTCTGTGATCAGCCGGGGGAACTCTGTGACCATCCGGTGTCAGGGGACC
CTGGAGGCCCAGGAATACCGTCTGGTTAAAGAGGGAAGCCCAGAACCCTGGGACACACAGAACCCACTGG
AGCCCAAGAACAAGGCCAGATTCTCCATCCCATCCATGACAGAGCACCATGCAGGGAGATACCGCTGTTA
CTACTACAGCCCTGCAGGCTGGTCAGAGCCCAGCGACCCCCTGGAGCTGGTGGTGACAGGATTCTACAAC
AAACCCACCCTCTCAGCCCTGCCCAGTCCTGTGGTGACCTCAGGAGAGAACGTGACCCTCCAGTGTGGCT
CACGGCTGAGATTCGACAGGTTCATTCTGACTGAGGAAGGAGACCACAAGCTCTCCTGGACCTTGGACTC
ACAGCTGACCCCCAGTGGGCAGTTCCAGGCCCTGTTCCCTGTGGGCCCTGTGACCCCCAGCCACAGGTGG
ATGCTCAGATGCTATGGCTCTCGCAGGCATATCCTGCAGGTATGGTCAGAACCCAGTGACCTCCTGGAGA
TTCCGGTCTCAGGTGAGGAAGCCACAGTCTTCTCTAGTACAATTCAGGGAAGCCAGACAGGTTGTGGAGA
GCTTTACAGGCAGGGCAGCCCCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219364 representing NM_181879
Red=Cloning site Green=Tags(s)

MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGT
LEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYN
KPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRW
MLRCYGSRRHILQVWSEPSDLLEIPVSGEEATVFSSTIQGSQTGCGELYRQGSPC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_181879
ORF Size 795 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_181879.3
RefSeq Size 1081 bp
RefSeq ORF 798 bp
Locus ID 353514
UniProt ID A6NI73
MW 29.1 kDa
Gene Summary The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...