HOXA1 (NM_153620) Human Tagged ORF Clone
CAT#: RC222721
HOXA1 (Myc-DDK-tagged)-Human homeobox A1 (HOXA1), transcript variant 2
ORF Plasmid: tGFP
"NM_153620" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,200.00
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | BSAS; HOX1; HOX1F |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC222721 representing NM_153620
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACAATGCAAGAATGAACTCCTTCCTGGAATACCCCATACTTAGCAGTGGCGACTCGGGGACCTGCT CAGCCCGAGCCTACCCCTCGGACCATAGGATTACAACTTTCCAGTCGTGCGCGGTCAGCGCCAACAGTTG CGGCGGCGACGACCGCTTCCTAGTGGGCAGGGGGGTGCAGATCGGTTCGCCCCACCACCACCACCACCAC CACCATCACCACCCCCAGCCGGCTACCTACCAGACTTCCGGGAACCTGGGGGTGTCCTACTCCCACTCAA GTTGTGGTCCAAGCTATGGCTCACAGAACTTCAGTGCGCCTTACAGCCCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC222721 representing NM_153620
Red=Cloning site Green=Tags(s) MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHH HHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSP myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_153620 |
ORF Size | 331 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq Size | 2358 bp |
RefSeq ORF | 414 bp |
Locus ID | 3198 |
UniProt ID | P49639 |
Protein Families | Druggable Genome, Transcription Factors |
MW | 14.6 kDa |
Gene Summary | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC222721L1 | Lenti ORF clone of Human homeobox A1 (HOXA1), transcript variant 2, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC222721L2 | Lenti ORF clone of Human homeobox A1 (HOXA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RC222721L3 | Lenti ORF clone of Human homeobox A1 (HOXA1), transcript variant 2, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC222721L4 | Lenti ORF clone of Human homeobox A1 (HOXA1), transcript variant 2, mGFP tagged |
CNY 5,890.00 |
|
RG222721 | HOXA1 (tGFP-tagged) - Human homeobox A1 (HOXA1), transcript variant 2 |
CNY 2,800.00 |
|
SC306628 | HOXA1 (untagged)-Human homeobox A1 (HOXA1), transcript variant 2 |
CNY 3,990.00 |