SPAG11B (NM_058206) Human Tagged ORF Clone
CAT#: RC224870
- TrueORF®
SPAG11B (Myc-DDK-tagged)-Human sperm associated antigen 11B (SPAG11B), transcript variant B
ORF Plasmid: tGFP
"NM_058206" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 3,990.00
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11; SPAG11A |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC224870 representing NM_058206
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGGTCTTTTTTCTGTTTGCTGTTCTCTTTTGTTTGGTCCAAACAAACTCAGTGCACATCTCTCACC GGGAGGCTCGAGGACCCTCATTTAGGATCTGTGTGGACTTTTTAGGGCCTAGATGGGCCAGGGGATGTTC CACCGGGAAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC224870 representing NM_058206
Red=Cloning site Green=Tags(s) MKVFFLFAVLFCLVQTNSVHISHREARGPSFRICVDFLGPRWARGCSTGN myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_058206 |
ORF Size | 150 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_058206.4 |
RefSeq Size | 520 bp |
RefSeq ORF | 153 bp |
Locus ID | 10407 |
UniProt ID | Q08648 |
Protein Families | Secreted Protein |
MW | 5.7 kDa |
Gene Summary | This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC224870L3 | Lenti-ORF clone of SPAG11B (Myc-DDK-tagged)-Human sperm associated antigen 11B (SPAG11B), transcript variant B |
CNY 5,890.00 |
|
RC224870L4 | Lenti-ORF clone of SPAG11B (mGFP-tagged)-Human sperm associated antigen 11B (SPAG11B), transcript variant B |
CNY 5,890.00 |
|
RG224870 | SPAG11B (tGFP-tagged) - Human sperm associated antigen 11B (SPAG11B), transcript variant B |
CNY 4,370.00 |
|
SC305772 | SPAG11B (untagged)-Human sperm associated antigen 11B (SPAG11B), transcript variant B |
CNY 3,990.00 |
其它SPAG11B产品