NEIL2 (NM_001135747) Human Tagged ORF Clone

CAT#: RC227916

  • TrueORF®

NEIL2 (Myc-DDK-tagged)-Human nei endonuclease VIII-like 2 (E. coli) (NEIL2), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001135747" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

CNY 3,990.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


NEIL2 Antibody - N-terminal region
    • 100 ul

CNY 5,250.00

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Synonyms NEH2; NEI2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC227916 representing NM_001135747
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCCTGGCAGCAGCCCAACACCAGAGCCTCCACAAAAAGAAGTGCAGAAGGAAGGGGCTGCGG
ACCCAAAGCAGGTCGGGGAGCCCAGCGGGCAGAAGACCCTTGATGGATCCTCACGGTCTGCAGAGCTCGT
CCCCCAGGGCGAGGATGATTCTGAGTATTTGGAGAGAGACGCCCCTGCAGGAGATGCTGGGAGGTGGCTG
CGTGTCAGCTTTGGTTTGTTTGGCAGCGTTTGGGTGAACGATTTCTCCAGAGCCAAGAAAGCCAACAAGA
GGGGGGACTGGAGGGACCCTTCCCCGAGGTTGGTCCTGCACTTTGGTGGTGGTGGCTTCCTGGCATTTTA
TAATTGTCAGTTGTCTTGGAGCTCTTCCCCAGTGGTCACACCCACCTGTGACATCCTGTCTGAGAAGTTC
CATCGAGGACAAGCCTTAGAAGCTCTAGGCCAGGCTCAGCCTGTCTGCTATACACTGCTGGACCAGAGAT
ACTTCTCAGGGCTAGGGAACATCATTAAGAATGAAGCCTTGTACAGAGCTGGGATCCATCCCCTTTCTCT
CGGTTCAGTCCTGAGTGCCTCGCGTCGGGAGGTCCTGGTGGATCACGTGGTGGAGTTCAGTACAGCCTGG
CTGCAGGGCAAGTTCCAAGGCAGACCGCAGCACACACAGGTCTACCAGAAAGAACAGTGCCCTGCTGGCC
ACCAGGTCATGAAGGAGGCGTTTGGGCCCGAAGATGGGTTACAGAGGCTCACCTGGTGGTGCCCGCAGTG
CCAGCCCCAGTTGTCAGAGGAGCCAGAGCAGTGCCAGTTCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC227916 representing NM_001135747
Red=Cloning site Green=Tags(s)

MGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWL
RVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKF
HRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAW
LQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001135747
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001135747.3
RefSeq Size 2062 bp
RefSeq ORF 816 bp
Locus ID 252969
UniProt ID Q969S2
Protein Families Druggable Genome
Protein Pathways Base excision repair
MW 29.9 kDa
Gene Summary This gene encodes a member of the Fpg/Nei family of DNA glycosylases. These glycosylases initiate the first step in base excision repair by cleaving oxidatively damaged bases and introducing a DNA strand break via their abasic site lyase activity. This enzyme is primarily associated with DNA repair during transcription and acts prefentially on cytosine-derived lesions, particularly 5-hydroxyuracil and 5-hydroxycytosine. It contains an N-terminal catalytic domain, a hinge region, and a C-terminal DNA-binding domain with helix-two-turn-helix and zinc finger motifs. This enzyme interacts with the X-ray cross complementing factor 1 scaffold protein as part of a multi-protein DNA repair complex. A pseudogene of this gene has been identified. [provided by RefSeq, Mar 2017]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...