DDIT3 (NM_001195053) Human Tagged ORF Clone
CAT#: RC231040
DDIT3 (Myc-DDK-tagged)-Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1
ORF Plasmid: tGFP
"NM_001195053" in other vectors (5)
Need custom modification / cloning service?
Get a free quote
CNY 3,600.00
CNY 4,180.00
Cited in 2 publications. |
CNY 300.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | AltDDIT3; C/EBPzeta; CEBPZ; CHOP; CHOP-10; CHOP10; GADD153 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC231040 representing NM_001195053
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGCTTGTTCCAGCCACTCCCCATTATCCTGCAGATGTGCTTTTCCAGACTGATCCAACTGCAGAGA TGGCAGCTGAGTCATTGCCTTTCTCCTTTGGGACACTGTCCAGCTGGGAGCTGGAAGCCTGGTATGAGGA CCTGCAAGAGGTCCTGTCTTCAGATGAAAATGGGGGTACCTATGTTTCACCTCCTGGAAATGAAGAGGAA GAATCAAAAATCTTCACCACTCTTGACCCTGCTTCTCTGGCTTGGCTGACTGAGGAGGAGCCAGAACCAG CAGAGGTCACAAGCACCTCCCAGAGCCCTCACTCTCCAGATTCCAGTCAGAGCTCCCTGGCTCAGGAGGA AGAGGAGGAAGACCAAGGGAGAACCAGGAAACGGAAACAGAGTGGTCATTCCCCAGCCCGGGCTGGAAAG CAGCGCATGAAGGAGAAAGAACAGGAGAATGAAAGGAAAGTGGCACAGCTAGCTGAAGAGAATGAACGGC TCAAGCAGGAAATCGAGCGCCTGACCAGGGAAGTAGAGGCGACTCGCCGAGCTCTGATTGACCGAATGGT GAATCTGCACCAAGCA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC231040 representing NM_001195053
Red=Cloning site Green=Tags(s) MELVPATPHYPADVLFQTDPTAEMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEE ESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGK QRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001195053 |
ORF Size | 576 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001195053.1, NP_001181982.1 |
RefSeq ORF | 579 bp |
Locus ID | 1649 |
UniProt ID | P35638 |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway |
MW | 22.1 kDa |
Gene Summary | This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
miR-1271 inhibits ERα expression and confers letrozole resistance in breast cancer
,Yu, T;Yu, HR;Sun, JY;Zhao, Z;Li, S;Zhang, XF;Liao, ZX;Cui, MK;Li, J;Li, C;Zhang, Q;,
Oncotarget
,PubMed ID 29291017
[DDIT3]
|
Differential expression of endoplasmic reticulum stress-response proteins in different renal tubule subtypes of OVE26 diabetic mice
,Barati, MT;Powell, DW;Kechavarzi, BD;Isaacs, SM;Zheng, S;Epstein, PN;Cai, L;Coventry, S;Rane, MJ;Klein, JB;,
Cell Stress Chaperones
,PubMed ID 26483256
[DDIT3]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC231040L1 | Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1, Myc-DDK-tagged |
CNY 6,000.00 |
|
RC231040L2 | Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC231040L3 | Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1, Myc-DDK-tagged |
CNY 5,890.00 |
|
RC231040L4 | Lenti ORF clone of Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RG231040 | DDIT3 (tGFP-tagged) - Human DNA-damage-inducible transcript 3 (DDIT3), transcript variant 1 |
CNY 5,200.00 |