MAP1LC3A (NM_032514) Human Tagged ORF Clone
CAT#: RG202222
- TrueORF®
MAP1LC3A (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1
ORF Plasmid: DDK
"NM_032514" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,800.00
CNY 4,370.00
Cited in 9 publications. |
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG202222 representing NM_032514
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTCAGACCGGCCTTTCAAGCAGCGGCGGAGCTTCGCCGACCGCTGTAAGGAGGTACAGCAGATCC GCGACCAGCACCCCAGCAAAATCCCGGTGATCATCGAGCGCTACAAGGGTGAGAAGCAGCTGCCCGTCCT GGACAAGACCAAGTTTTTGGTCCCGGACCATGTCAACATGAGCGAGTTGGTCAAGATCATCCGGCGCCGC CTGCAGCTGAACCCCACGCAGGCCTTCTTCCTGCTGGTGAACCAGCACAGCATGGTGAGTGTGTCCACGC CCATCGCGGACATCTACGAGCAGGAGAAAGACGAGGACGGCTTCCTCTATATGGTCTACGCCTCCCAGGA AACCTTCGGCTTC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG202222 representing NM_032514
Red=Cloning site Green=Tags(s) MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032514 |
ORF Size | 363 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032514.4 |
RefSeq Size | 1030 bp |
RefSeq ORF | 366 bp |
Locus ID | 84557 |
UniProt ID | Q9H492 |
Domains | MAP1_LC3 |
Gene Summary | MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012] |
Citations (9)
The use of this cDNA Clones has been cited in the following citations: |
---|
miR‑92b promotes autophagy and suppresses viability and invasion in breast cancer by targeting EZH2
,Liu, F;Sang, M;Meng, L;Gu, L;Liu, S;Li, J;Geng, C;,
Int. J. Oncol.
,PubMed ID 30066891
[MAP1LC3A]
|
A novel ECG analog 4-(S)-(2,4,6-trimethylthiobenzyl)-epigallocatechin gallate selectively induces apoptosis of B16-F10 melanoma via activation of autophagy and ROS
,Xie, J;Yun, JP;Yang, YN;Hua, F;Zhang, XW;Lin, H;Lv, XX;Li, K;Zhang, PC;Hu, ZW;,
Sci Rep
,PubMed ID 28186123
[MAP1LC3A]
|
A Cyanine Dye to Probe Mitophagy: Simultaneous Detection of Mitochondria and Autolysosomes in Live Cells
,Liu, Y;Zhou, J;Wang, L;Hu, X;Liu, X;Liu, M;Cao, Z;Shangguan, D;Tan, W;,
J. Am. Chem. Soc.
,PubMed ID 27574920
[MAP1LC3A]
|
Newcastle disease virus NP and P proteins induce autophagy via the endoplasmic reticulum stress-related unfolded protein response
,Cheng, JH;Sun, YJ;Zhang, FQ;Zhang, XR;Qiu, XS;Yu, LP;Wu, YT;Ding, C;,
Sci Rep
,PubMed ID 27097866
[MAP1LC3A]
|
Metformin Restores Parkin-Mediated Mitophagy, Suppressed by Cytosolic p53
,Song, YM;Lee, WK;Lee, YH;Kang, ES;Cha, BS;Lee, BW;,
Int J Mol Sci
,PubMed ID 26784190
[MAP1LC3A]
|
Bone marrow-derived mesenchymal stem cells ameliorate chronic high glucose-induced ß-cell injury through modulation of autophagy
,Zhao, K;Hao, H;Liu, J;Tong, C;Cheng, Y;Xie, Z;Zang, L;Mu, Y;Han, W;,
Cell Death Dis
,PubMed ID 26379190
[MAP1LC3A]
|
Nuclear localization of the p17 protein of avian reovirus is correlated with autophagy induction and an increase in viral replication
,Li, C;Wei, H;Yu, L;Duan, S;Cheng, J;Yan, W;Zhang, X;Wu, Y;,
Arch. Virol.
,PubMed ID 26350773
[MAP1LC3A]
|
Manipulation of autophagy by HCMV infection is involved in mTOR and influences the replication of virus
,Zhao, J;Li, Z;Wang, M;Zhang, Z;Ma, H;Chang, J;Gao, D;Wang, S;,
Acta Biochim Biophys Sin (Shanghai). 2013 Nov;45(11):979-81
,PubMed ID 24108761
[MAP1LC3A]
|
Autophagy benefits the replication of Newcastle disease virus in chicken cells and tissues
,Sun, Y;Yu, S;Ding, N;Meng, C;Meng, S;Zhang, S;Zhan, Y;Qiu, X;Tan, L;Chen, H;Song, C;Ding, C;,
J Virol. 2013 Oct 30
,PubMed ID 24173218
[MAP1LC3A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC202222 | MAP1LC3A (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 |
CNY 1,200.00 |
|
RC202222L1 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202222L2 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
RC202222L3 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC202222L4 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
SC111851 | MAP1LC3A (untagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 |
CNY 1,200.00 |
其它MAP1LC3A产品