S100A4 (NM_002961) Human Tagged ORF Clone
CAT#: RG203035
- TrueORF®
S100A4 (tGFP-tagged) - Human S100 calcium binding protein A4 (S100A4), transcript variant 1
ORF Plasmid: DDK
"NM_002961" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 2,800.00
CNY 4,370.00
Cited in 3 publications. |
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Synonyms | 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG203035 representing NM_002961
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGTGCCCTCTGGAGAAGGCCCTGGATGTGATGGTGTCCACCTTCCACAAGTACTCGGGCAAAGAGG GTGACAAGTTCAAGCTCAACAAGTCAGAACTAAAGGAGCTGCTGACCCGGGAGCTGCCCAGCTTCTTGGG GAAAAGGACAGATGAAGCTGCTTTCCAGAAGCTGATGAGCAACTTGGACAGCAACAGGGACAACGAGGTG GACTTCCAAGAGTACTGTGTCTTCCTGTCCTGCATCGCCATGATGTGTAACGAATTCTTTGAAGGCTTCC CAGATAAGCAGCCCAGGAAGAAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG203035 representing NM_002961
Red=Cloning site Green=Tags(s) MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK TRTRPLE - GFP Tag - V |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_002961 |
ORF Size | 303 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_002961.3 |
RefSeq Size | 512 bp |
RefSeq ORF | 306 bp |
Locus ID | 6275 |
UniProt ID | P26447 |
Domains | S_100, EFh |
Gene Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Hyaluronan/CD44 Axis Regulates S100A4 Mediated Mesenchymal Progenitor Cell Fibrogenicity in Idiopathic Pulmonary Fibrosis
,Xia, H;Herrera, J;Smith, K;Yang, L;Gilbertsen, AJ;Benyumov, A;Racila, E;Bitterman, PB;Henke, CA;,
American journal of physiology. Lung cellular and molecular physiology
,PubMed ID 33719561
[S100A4]
|
Calcium-binding protein S100A4 confers mesenchymal progenitor cell fibrogenicity in idiopathic pulmonary fibrosis
,Xia, H;Gilbertsen, A;Herrera, J;Racila, E;Smith, K;Peterson, M;Griffin, T;Benyumov, A;Yang, L;Bitterman, PB;Henke, CA;,
J. Clin. Invest.
,PubMed ID 28530639
[S100A4]
|
Extracellular matrix 1 (ECM1) regulates the actin cytoskeletal architecture of aggressive breast cancer cells in part via S100A4 and Rho-family GTPases
,Gómez-Contreras, P;Ramiro-Díaz, JM;Sierra, A;Stipp, C;Domann, FE;Weigel, RJ;Lal, G;,
Clin. Exp. Metastasis
,PubMed ID 27770373
[S100A4]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203035 | S100A4 (Myc-DDK-tagged)-Human S100 calcium binding protein A4 (S100A4), transcript variant 1 |
CNY 1,200.00 |
|
RC203035L1 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203035L2 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, mGFP tagged |
CNY 5,890.00 |
|
RC203035L3 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, Myc-DDK-tagged |
CNY 3,600.00 |
|
RC203035L4 | Lenti ORF clone of Human S100 calcium binding protein A4 (S100A4), transcript variant 1, mGFP tagged |
CNY 3,600.00 |
|
SC118301 | S100A4 (untagged)-Human S100 calcium binding protein A4 (S100A4), transcript variant 1 |
CNY 1,200.00 |